Diaphorina citri psyllid: psy8405

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MALLKMELLGIGPFPKKRGRKRKHFSVVAEQKDLSQQSNENNQGLKSGDHENIHNVNTSKIGIKTEENPTLDGGNIKIPKKRGRKRKYPLANLIQPTSNHTPDGTVVKKKRGRKRKYPLPTVEPEEVAYKGSQHNNSVNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPSENNASKQSSSQ
cccHHHHHccccccccccccccccccEEEECccccHHHccccccccccccccccccccccccccccccccccccCEECccccccccccccccccccccccccHHHHHHHHcccccccccccccccHHHcccccccccccHHHHHHHHHccccccccccccccEEEcEEEEccEEEEEEEEcccccccCCcHHHHHHccccHHHHHHHHHcccccccccccccccc
***LK*ELLGIG*************************************************************************************SNHTP*************************************************NLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVF*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLKMELLGIGPFPKKRGRKRKHFSVVAEQKDLSQQSNENNQGLKSGDHENIHNVNTSKIGIKTEENPTLDGGNIKIPKKRGRKRKYPLANLIQPTSNHTPDGTVVKKKRGRKRKYPLPTVEPEEVAYKGSQHNNSVNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPSENNASKQSSSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031981 [CC]nuclear lumenprobableGO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0010369 [CC]chromocenterprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0000775 [CC]chromosome, centromeric regionprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3Q6S, chain A
Confidence level:very confident
Coverage over the Query: 151-216
View the alignment between query and template
View the model in PyMOL
Template: 2H1E, chain A
Confidence level:probable
Coverage over the Query: 41-92,119-133,144-207
View the alignment between query and template
View the model in PyMOL