Psyllid ID: psy8405
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 225 | ||||||
| 225714588 | 201 | Chromobox protein homolog 1 [Lepeophthei | 0.373 | 0.417 | 0.404 | 2e-09 | |
| 225714180 | 199 | Chromobox protein homolog 1 [Lepeophthei | 0.36 | 0.407 | 0.419 | 2e-09 | |
| 225713868 | 202 | Chromobox protein homolog 1 [Lepeophthei | 0.373 | 0.415 | 0.404 | 2e-09 | |
| 225712476 | 202 | Chromobox protein homolog 1 [Lepeophthei | 0.373 | 0.415 | 0.404 | 2e-09 | |
| 225712178 | 201 | Chromobox protein homolog 1 [Lepeophthei | 0.373 | 0.417 | 0.404 | 2e-09 | |
| 290561793 | 202 | Chromobox protein homolog 1 [Lepeophthei | 0.373 | 0.415 | 0.404 | 2e-09 | |
| 290462581 | 203 | Chromobox protein homolog 1 [Lepeophthei | 0.373 | 0.413 | 0.404 | 2e-09 | |
| 225713332 | 203 | Chromobox protein homolog 1 [Lepeophthei | 0.373 | 0.413 | 0.404 | 2e-09 | |
| 225712384 | 203 | Chromobox protein homolog 1 [Lepeophthei | 0.373 | 0.413 | 0.404 | 2e-09 | |
| 225712028 | 203 | Chromobox protein homolog 1 [Lepeophthei | 0.373 | 0.413 | 0.404 | 3e-09 |
| >gi|225714588|gb|ACO13140.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
Score = 68.9 bits (167), Expect = 2e-09, Method: Compositional matrix adjust.
Identities = 34/84 (40%), Positives = 49/84 (58%)
Query: 133 QHNNSVNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAE 192
+ +S N+ K +D G DRNL E IIGAT G +L+ W+GSDEADL+PA
Sbjct: 111 KSTSSSNEKSKSRKADDDRPRGFDRNLDPERIIGATDSSGELMFLIKWKGSDEADLVPAR 170
Query: 193 ICKRKYPQPLIRFFEQHLVFPSEN 216
+ PQ +I+F+E+ L + + N
Sbjct: 171 EANVRCPQTVIKFYEERLTWHTSN 194
|
Source: Lepeophtheirus salmonis Species: Lepeophtheirus salmonis Genus: Lepeophtheirus Family: Caligidae Order: Siphonostomatoida Class: Maxillopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|225714180|gb|ACO12936.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
| >gi|225713868|gb|ACO12780.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
| >gi|225712476|gb|ACO12084.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
| >gi|225712178|gb|ACO11935.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
| >gi|290561793|gb|ADD38294.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
| >gi|290462581|gb|ADD24338.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
| >gi|225713332|gb|ACO12512.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
| >gi|225712384|gb|ACO12038.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
| >gi|225712028|gb|ACO11860.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 225 | ||||||
| UNIPROTKB|G3V1X9 | 190 | CBX5 "Chromobox protein homolo | 0.448 | 0.531 | 0.367 | 9.4e-11 | |
| MGI|MGI:109372 | 191 | Cbx5 "chromobox 5" [Mus muscul | 0.448 | 0.528 | 0.373 | 9.4e-11 | |
| RGD|1306619 | 191 | Cbx5 "chromobox homolog 5" [Ra | 0.448 | 0.528 | 0.373 | 9.4e-11 | |
| UNIPROTKB|F2Z4J7 | 191 | CBX5 "Uncharacterized protein" | 0.448 | 0.528 | 0.364 | 1.5e-10 | |
| UNIPROTKB|P45973 | 191 | CBX5 "Chromobox protein homolo | 0.448 | 0.528 | 0.364 | 1.5e-10 | |
| UNIPROTKB|F2Z5T3 | 191 | LOC100519426 "Uncharacterized | 0.448 | 0.528 | 0.364 | 1.5e-10 | |
| ZFIN|ZDB-GENE-030131-1158 | 177 | cbx3a "chromobox homolog 3a (H | 0.408 | 0.519 | 0.387 | 1.5e-10 | |
| UNIPROTKB|E2QYK6 | 191 | CBX5 "Uncharacterized protein" | 0.448 | 0.528 | 0.355 | 3.2e-10 | |
| UNIPROTKB|I3LQ28 | 190 | I3LQ28 "Uncharacterized protei | 0.444 | 0.526 | 0.364 | 6.6e-10 | |
| UNIPROTKB|G5E6N7 | 185 | CBX1 "Uncharacterized protein" | 0.36 | 0.437 | 0.392 | 1.4e-09 |
| UNIPROTKB|G3V1X9 CBX5 "Chromobox protein homolog 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 150 (57.9 bits), Expect = 9.4e-11, P = 9.4e-11
Identities = 39/106 (36%), Positives = 60/106 (56%)
Query: 123 EPEEVAYKGSQHNNSVNDIVVKEKL-LNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWE 181
E E + S +NS +DI K+K ND+ G +R L E+IIGAT G +L+ W+
Sbjct: 83 EKSESNKRKSNFSNSADDIKSKKKRESNDIARGFERGLEPEKIIGATDSCGDLMFLMKWK 142
Query: 182 GSDEADLLPAEICKRKYPQPLIRFFEQHLV---FPSE-NNASKQSS 223
+DEADL+ A+ K PQ +I F+E+ L +P + N K+++
Sbjct: 143 DTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETA 188
|
|
| MGI|MGI:109372 Cbx5 "chromobox 5" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1306619 Cbx5 "chromobox homolog 5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z4J7 CBX5 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P45973 CBX5 "Chromobox protein homolog 5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F2Z5T3 LOC100519426 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-1158 cbx3a "chromobox homolog 3a (HP1 gamma homolog, Drosophila)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QYK6 CBX5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LQ28 I3LQ28 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5E6N7 CBX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 225 | |||
| pfam01393 | 57 | pfam01393, Chromo_shadow, Chromo shadow domain | 1e-08 | |
| smart00300 | 61 | smart00300, ChSh, Chromo Shadow Domain | 2e-07 | |
| cd00034 | 54 | cd00034, ChSh, Chromo Shadow Domain, found in asso | 1e-05 |
| >gnl|CDD|201767 pfam01393, Chromo_shadow, Chromo shadow domain | Back alignment and domain information |
|---|
Score = 49.7 bits (119), Expect = 1e-08
Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 1/56 (1%)
Query: 157 RNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVF 212
R L +E+I+GAT G +L ++ DEADL+PA+ K PQ +I F+E+ L +
Sbjct: 1 RGLELEKIVGATDSPGELHFLCKFKD-DEADLVPAKEANVKCPQQVIAFYEERLTW 55
|
This domain is distantly related to pfam00385. This domain is always found in association with a chromo domain. Length = 57 |
| >gnl|CDD|197638 smart00300, ChSh, Chromo Shadow Domain | Back alignment and domain information |
|---|
| >gnl|CDD|237998 cd00034, ChSh, Chromo Shadow Domain, found in association with N-terminal chromo (CHRromatin Organization MOdifier) domain; Chromo domains mediate the interaction of the heterochromatin with other heterochromatin proteins, thereby affecting chromatin structure (e | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| smart00300 | 61 | ChSh Chromo Shadow Domain. | 99.92 | |
| PF01393 | 58 | Chromo_shadow: Chromo shadow domain Web page maint | 99.91 | |
| cd00034 | 54 | ChSh Chromo Shadow Domain, found in association wi | 99.84 | |
| KOG1911|consensus | 270 | 99.67 | ||
| smart00298 | 55 | CHROMO Chromatin organization modifier domain. | 98.27 | |
| PF00385 | 55 | Chromo: Chromo (CHRromatin Organisation MOdifier) | 97.72 | |
| cd00024 | 55 | CHROMO Chromatin organization modifier (chromo) do | 97.55 | |
| PF00385 | 55 | Chromo: Chromo (CHRromatin Organisation MOdifier) | 96.28 | |
| KOG1911|consensus | 270 | 96.25 | ||
| cd00024 | 55 | CHROMO Chromatin organization modifier (chromo) do | 94.16 | |
| KOG2748|consensus | 369 | 93.06 | ||
| KOG2748|consensus | 369 | 92.4 | ||
| smart00298 | 55 | CHROMO Chromatin organization modifier domain. | 92.11 |
| >smart00300 ChSh Chromo Shadow Domain | Back alignment and domain information |
|---|
Probab=99.92 E-value=9.5e-26 Score=162.22 Aligned_cols=61 Identities=38% Similarity=0.674 Sum_probs=59.3
Q ss_pred CCCCCCCcccceeeeeeeCCceEEEEEeCCCCCcceeehhHHHhhCCHHHHHHHHhhccCCC
Q psy8405 153 LGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPS 214 (225)
Q Consensus 153 ~GF~RGLepEkIIGatd~~GeL~FLVKWKg~de~DlVpA~eaneKcPQmVIkFYEerL~w~~ 214 (225)
.||+||+++|+|||+++.+|+|+|||+|+| +++++||+.+||.+|||+||+|||+||+|++
T Consensus 1 ~gf~~g~~~e~Ivg~~d~~G~l~flikwk~-~~~~lVp~~~~~~k~P~~vI~FYE~~l~~~~ 61 (61)
T smart00300 1 KDEERGKSWEDIVGITKDDGELTFLIKWKD-DAASLVPNKEANVKCPQKVIRFYESHLTFQS 61 (61)
T ss_pred CccccCCCHHHHhceecCCCeEEEEEEEeC-CcEEEEEHHHHHHHChHHHHHHHHHhCccCC
Confidence 389999999999999999999999999999 9999999999999999999999999999974
|
|
| >PF01393 Chromo_shadow: Chromo shadow domain Web page maintained by Rein Aasland; InterPro: IPR008251 Chromo shadow domain is distantly related to chromo domain | Back alignment and domain information |
|---|
| >cd00034 ChSh Chromo Shadow Domain, found in association with N-terminal chromo (CHRromatin Organization MOdifier) domain; Chromo domains mediate the interaction of the heterochromatin with other heterochromatin proteins, thereby affecting chromatin structure (e | Back alignment and domain information |
|---|
| >KOG1911|consensus | Back alignment and domain information |
|---|
| >smart00298 CHROMO Chromatin organization modifier domain | Back alignment and domain information |
|---|
| >PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation | Back alignment and domain information |
|---|
| >cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus | Back alignment and domain information |
|---|
| >PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation | Back alignment and domain information |
|---|
| >KOG1911|consensus | Back alignment and domain information |
|---|
| >cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus | Back alignment and domain information |
|---|
| >KOG2748|consensus | Back alignment and domain information |
|---|
| >KOG2748|consensus | Back alignment and domain information |
|---|
| >smart00298 CHROMO Chromatin organization modifier domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 225 | ||||
| 1s4z_A | 75 | Hp1 Chromo Shadow Domain In Complex With Pxvxl Moti | 6e-08 | ||
| 3q6s_A | 78 | The Crystal Structure Of The Heterochromatin Protei | 6e-08 | ||
| 3p7j_A | 87 | Drosophila Hp1a Chromo Shadow Domain Length = 87 | 7e-08 | ||
| 3i3c_A | 75 | Crystal Structural Of Cbx5 Chromo Shadow Domain Len | 7e-08 | ||
| 2fmm_A | 74 | Crystal Structure Of Emsy-Hp1 Complex Length = 74 | 3e-07 | ||
| 1dz1_A | 70 | Mouse Hp1 (M31) C Terminal (Shadow Chromo) Domain L | 3e-07 | ||
| 3kup_A | 65 | Crystal Structure Of The Cbx3 Chromo Shadow Domain | 2e-06 |
| >pdb|1S4Z|A Chain A, Hp1 Chromo Shadow Domain In Complex With Pxvxl Motif Of Caf- 1 Length = 75 | Back alignment and structure |
|
| >pdb|3Q6S|A Chain A, The Crystal Structure Of The Heterochromatin Protein 1 Beta Chromoshadow Domain Complexed With A Peptide From Shugoshin 1 Length = 78 | Back alignment and structure |
| >pdb|3P7J|A Chain A, Drosophila Hp1a Chromo Shadow Domain Length = 87 | Back alignment and structure |
| >pdb|3I3C|A Chain A, Crystal Structural Of Cbx5 Chromo Shadow Domain Length = 75 | Back alignment and structure |
| >pdb|2FMM|A Chain A, Crystal Structure Of Emsy-Hp1 Complex Length = 74 | Back alignment and structure |
| >pdb|1DZ1|A Chain A, Mouse Hp1 (M31) C Terminal (Shadow Chromo) Domain Length = 70 | Back alignment and structure |
| >pdb|3KUP|A Chain A, Crystal Structure Of The Cbx3 Chromo Shadow Domain Length = 65 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 225 | |||
| 3i3c_A | 75 | Chromobox protein homolog 5; CBX5, chromo shadow d | 8e-17 | |
| 3kup_A | 65 | Chromobox protein homolog 3; chromo shadow domain, | 1e-16 | |
| 3q6s_A | 78 | Chromobox protein homolog 1; incenp, heterochromat | 1e-16 | |
| 2fmm_A | 74 | Chromobox protein homolog 1; ENT domain, chromo sh | 2e-16 | |
| 3p7j_A | 87 | Heterochromatin protein 1; chromo shadow domain, g | 4e-16 |
| >3i3c_A Chromobox protein homolog 5; CBX5, chromo shadow domain, structural genomics, structural consortium, SGC, centromere, nucleus, phosphoprotein; 2.48A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
Score = 71.4 bits (175), Expect = 8e-17
Identities = 28/74 (37%), Positives = 42/74 (56%)
Query: 137 SVNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKR 196
S + + ND+ G +R L E+IIGAT G +L+ W+ +DEADL+ A+
Sbjct: 1 SSGRENLYFQGSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANV 60
Query: 197 KYPQPLIRFFEQHL 210
K PQ +I F+E+ L
Sbjct: 61 KCPQIVIAFYEERL 74
|
| >3kup_A Chromobox protein homolog 3; chromo shadow domain, structural genomics consortium, SGC, acetylation, chromatin regulator, nucleus, phosphoprotein; 1.77A {Homo sapiens} PDB: 1dz1_A Length = 65 | Back alignment and structure |
|---|
| >3q6s_A Chromobox protein homolog 1; incenp, heterochromatin, centromere, cell cycle; 1.93A {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2fmm_A Chromobox protein homolog 1; ENT domain, chromo shadow domain, EMSY protein, heterochroma protein 1, transcription; 1.80A {Homo sapiens} SCOP: b.34.13.2 PDB: 1s4z_A Length = 74 | Back alignment and structure |
|---|
| >3p7j_A Heterochromatin protein 1; chromo shadow domain, gene silenc epigenetics, transcription; 2.30A {Drosophila melanogaster} Length = 87 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| 3q6s_A | 78 | Chromobox protein homolog 1; incenp, heterochromat | 99.96 | |
| 2fmm_A | 74 | Chromobox protein homolog 1; ENT domain, chromo sh | 99.95 | |
| 3p7j_A | 87 | Heterochromatin protein 1; chromo shadow domain, g | 99.95 | |
| 3kup_A | 65 | Chromobox protein homolog 3; chromo shadow domain, | 99.94 | |
| 3i3c_A | 75 | Chromobox protein homolog 5; CBX5, chromo shadow d | 99.93 | |
| 1e0b_A | 68 | SWI6 protein; chromatin-binding, chromodomain, sha | 99.83 | |
| 2h1e_A | 177 | Chromo domain protein 1; CHD1, tandem chromodomain | 98.8 | |
| 3fdt_A | 59 | Chromobox protein homolog 5; chromobox homolog5, C | 98.54 | |
| 3f2u_A | 55 | Chromobox protein homolog 1; human chromobox homol | 98.52 | |
| 3mts_A | 64 | Histone-lysine N-methyltransferase SUV39H1; histon | 98.48 | |
| 3g7l_A | 61 | Chromo domain-containing protein 1; chromodomain, | 98.45 | |
| 3lwe_A | 62 | M-phase phosphoprotein 8; MPP8, structural genomic | 98.41 | |
| 3i91_A | 54 | Chromobox protein homolog 8; chromobox homolog 8, | 98.37 | |
| 1ap0_A | 73 | Modifier protein 1; chromatin-binding, protein int | 98.36 | |
| 3h91_A | 54 | Chromobox protein homolog 2; human chromobox homol | 98.34 | |
| 1ap0_A | 73 | Modifier protein 1; chromatin-binding, protein int | 98.25 | |
| 1q3l_A | 69 | Heterochromatin protein 1; chromodomain, HP1, chro | 98.23 | |
| 1pfb_A | 55 | Polycomb protein; chromatin, histone methylation, | 98.2 | |
| 3f2u_A | 55 | Chromobox protein homolog 1; human chromobox homol | 98.17 | |
| 1pdq_A | 72 | Polycomb protein; methyllysine, chromodomain, poly | 98.17 | |
| 3fdt_A | 59 | Chromobox protein homolog 5; chromobox homolog5, C | 98.13 | |
| 2rso_A | 92 | Chromatin-associated protein SWI6; chromodomain, s | 98.13 | |
| 2dnv_A | 64 | Chromobox protein homolog 8; chromo domain, histon | 98.13 | |
| 2k1b_A | 73 | Chromobox protein homolog 7; alpha/beta protein, c | 98.13 | |
| 3mts_A | 64 | Histone-lysine N-methyltransferase SUV39H1; histon | 98.12 | |
| 1g6z_A | 70 | CLR4 protein; transferase; NMR {Schizosaccharomyce | 98.07 | |
| 1pfb_A | 55 | Polycomb protein; chromatin, histone methylation, | 98.06 | |
| 3i91_A | 54 | Chromobox protein homolog 8; chromobox homolog 8, | 98.03 | |
| 1pdq_A | 72 | Polycomb protein; methyllysine, chromodomain, poly | 98.01 | |
| 1g6z_A | 70 | CLR4 protein; transferase; NMR {Schizosaccharomyce | 98.01 | |
| 2k1b_A | 73 | Chromobox protein homolog 7; alpha/beta protein, c | 98.0 | |
| 1q3l_A | 69 | Heterochromatin protein 1; chromodomain, HP1, chro | 98.0 | |
| 2d9u_A | 74 | Chromobox protein homolog 2 (isoform 2); chromobox | 98.0 | |
| 2dnt_A | 78 | Chromodomain protein, Y chromosome-like, isoform B | 97.99 | |
| 2kvm_A | 74 | Chromobox protein homolog 7; histone modification, | 97.97 | |
| 3h91_A | 54 | Chromobox protein homolog 2; human chromobox homol | 97.96 | |
| 2dnv_A | 64 | Chromobox protein homolog 8; chromo domain, histon | 97.96 | |
| 3g7l_A | 61 | Chromo domain-containing protein 1; chromodomain, | 97.92 | |
| 3lwe_A | 62 | M-phase phosphoprotein 8; MPP8, structural genomic | 97.83 | |
| 2rsn_A | 75 | Chromo domain-containing protein 1; chromodomain, | 97.83 | |
| 2rso_A | 92 | Chromatin-associated protein SWI6; chromodomain, s | 97.8 | |
| 2b2y_A | 187 | CHD-1, chromodomain-helicase-DNA-binding protein 1 | 97.8 | |
| 2kvm_A | 74 | Chromobox protein homolog 7; histone modification, | 97.75 | |
| 4hae_A | 81 | CDY-like 2, chromodomain Y-like protein 2; protein | 97.74 | |
| 2dnt_A | 78 | Chromodomain protein, Y chromosome-like, isoform B | 97.73 | |
| 2rsn_A | 75 | Chromo domain-containing protein 1; chromodomain, | 97.71 | |
| 2d9u_A | 74 | Chromobox protein homolog 2 (isoform 2); chromobox | 97.52 | |
| 1x3p_A | 54 | Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot | 97.52 | |
| 1x3p_A | 54 | Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot | 97.48 | |
| 4hae_A | 81 | CDY-like 2, chromodomain Y-like protein 2; protein | 97.39 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 97.26 | |
| 2epb_A | 68 | Chromodomain-helicase-DNA-binding protein 6; struc | 96.91 | |
| 2ee1_A | 64 | Chromodomain helicase-DNA-binding protein 4; EC 3. | 96.83 | |
| 2epb_A | 68 | Chromodomain-helicase-DNA-binding protein 6; struc | 96.44 | |
| 2b2y_C | 115 | CHD-1, chromodomain-helicase-DNA-binding protein 1 | 95.44 | |
| 2b2y_A | 187 | CHD-1, chromodomain-helicase-DNA-binding protein 1 | 94.3 | |
| 2b2y_C | 115 | CHD-1, chromodomain-helicase-DNA-binding protein 1 | 93.93 | |
| 2ee1_A | 64 | Chromodomain helicase-DNA-binding protein 4; EC 3. | 93.88 | |
| 2h1e_A | 177 | Chromo domain protein 1; CHD1, tandem chromodomain | 91.09 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 85.23 |
| >3q6s_A Chromobox protein homolog 1; incenp, heterochromatin, centromere, cell cycle; 1.93A {Homo sapiens} SCOP: b.34.13.2 | Back alignment and structure |
|---|
Probab=99.96 E-value=8.1e-30 Score=191.01 Aligned_cols=72 Identities=39% Similarity=0.609 Sum_probs=64.9
Q ss_pred ccCCCCCCCCcccceeeeeeeCCceEEEEEeCCCCCcceeehhHHHhhCCHHHHHHHHhhccCCCCCchhhh
Q psy8405 150 DMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPSENNASKQ 221 (225)
Q Consensus 150 ~~~~GF~RGLepEkIIGatd~~GeL~FLVKWKg~de~DlVpA~eaneKcPQmVIkFYEerL~w~~~~~~~~q 221 (225)
++++||+|||+||+|||+++.+|+|+|||||||++++|+||+.+||.+||||||+|||+||+|+++++++.+
T Consensus 1 ~k~~Gf~rGle~EkI~g~~~~~Gel~fLvKWKg~~~~dlVpa~ean~k~PqlVI~FYE~~l~~~~~~~~~~~ 72 (78)
T 3q6s_A 1 EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDD 72 (78)
T ss_dssp -CCCGGGGCCCEEEEEEEECTTSSCEEEEEETTCSCEEEEEHHHHHHHSHHHHHHHHHTTEEEECCC-----
T ss_pred CCCCccccCCCceEEeeEEcCCCcEEEEEEECCCChhheEeHHHHHhhChHHHHHHHHHhcccccCCchhhh
Confidence 368999999999999999999999999999999999999999999999999999999999999998877644
|
| >2fmm_A Chromobox protein homolog 1; ENT domain, chromo shadow domain, EMSY protein, heterochroma protein 1, transcription; 1.80A {Homo sapiens} SCOP: b.34.13.2 PDB: 1s4z_A | Back alignment and structure |
|---|
| >3p7j_A Heterochromatin protein 1; chromo shadow domain, gene silenc epigenetics, transcription; 2.30A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3kup_A Chromobox protein homolog 3; chromo shadow domain, structural genomics consortium, SGC, acetylation, chromatin regulator, nucleus, phosphoprotein; 1.77A {Homo sapiens} SCOP: b.34.13.2 PDB: 1dz1_A | Back alignment and structure |
|---|
| >3i3c_A Chromobox protein homolog 5; CBX5, chromo shadow domain, structural genomics, structural consortium, SGC, centromere, nucleus, phosphoprotein; 2.48A {Homo sapiens} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >1e0b_A SWI6 protein; chromatin-binding, chromodomain, shadow, heterochromatin; HET: 1PG; 1.9A {Schizosaccharomyces pombe} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A | Back alignment and structure |
|---|
| >3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* | Back alignment and structure |
|---|
| >3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* | Back alignment and structure |
|---|
| >3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* | Back alignment and structure |
|---|
| >1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* | Back alignment and structure |
|---|
| >3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A | Back alignment and structure |
|---|
| >1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* | Back alignment and structure |
|---|
| >1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* | Back alignment and structure |
|---|
| >1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* | Back alignment and structure |
|---|
| >1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* | Back alignment and structure |
|---|
| >3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* | Back alignment and structure |
|---|
| >1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* | Back alignment and structure |
|---|
| >1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* | Back alignment and structure |
|---|
| >2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A | Back alignment and structure |
|---|
| >2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* | Back alignment and structure |
|---|
| >2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* | Back alignment and structure |
|---|
| >2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 | Back alignment and structure |
|---|
| >4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C | Back alignment and structure |
|---|
| >2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* | Back alignment and structure |
|---|
| >2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C | Back alignment and structure |
|---|
| >2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 225 | ||||
| d2fmma1 | 68 | b.34.13.2 (A:108-175) Heterochromatin protein 1, H | 9e-19 |
| >d2fmma1 b.34.13.2 (A:108-175) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Length = 68 | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: Chromo domain-like family: Chromo domain domain: Heterochromatin protein 1, HP1 species: Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]
Score = 75.1 bits (185), Expect = 9e-19
Identities = 28/64 (43%), Positives = 38/64 (59%)
Query: 154 GIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFP 213
G R L E IIGAT G +L+ W+ SDEADL+PA+ K PQ +I F+E+ L +
Sbjct: 5 GFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWH 64
Query: 214 SENN 217
S +
Sbjct: 65 SYPS 68
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 225 | |||
| d2fmma1 | 68 | Heterochromatin protein 1, HP1 {Mouse (Mus musculu | 99.96 | |
| d1e0ba_ | 61 | Heterochromatin protein 1, HP1 {Fission yeast (Sch | 99.03 | |
| d1pfba_ | 55 | Polycomb protein, Pc {Fruit fly (Drosophila melano | 98.18 | |
| d1q3la_ | 52 | Heterochromatin protein 1, HP1 {Fruit fly (Drosoph | 98.1 | |
| d2dnva1 | 52 | Chromobox protein homolog 8 {Mouse (Mus musculus) | 98.06 | |
| d1pfba_ | 55 | Polycomb protein, Pc {Fruit fly (Drosophila melano | 98.06 | |
| d2dnva1 | 52 | Chromobox protein homolog 8 {Mouse (Mus musculus) | 97.96 | |
| d1guwa_ | 73 | Heterochromatin protein 1, HP1 {Mouse (Mus musculu | 97.95 | |
| d2dnta1 | 66 | Chromodomain protein, Y-like isoform {Human (Homo | 97.93 | |
| d1q3la_ | 52 | Heterochromatin protein 1, HP1 {Fruit fly (Drosoph | 97.88 | |
| d2dnta1 | 66 | Chromodomain protein, Y-like isoform {Human (Homo | 97.84 | |
| d1guwa_ | 73 | Heterochromatin protein 1, HP1 {Mouse (Mus musculu | 97.84 | |
| d1g6za_ | 70 | Histone methyltransferase clr4, chromo domain {Fis | 97.69 | |
| d1g6za_ | 70 | Histone methyltransferase clr4, chromo domain {Fis | 97.59 | |
| d2dy8a1 | 69 | ATP-dependent helicase CHD1 (Chromo domain protein | 97.58 | |
| d2b2ya1 | 80 | ATP-dependent helicase CHD1 (Chromo domain protein | 97.51 | |
| d1x3pa1 | 54 | CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId | 97.37 | |
| d1x3pa1 | 54 | CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId | 97.27 | |
| d3deoa1 | 44 | CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId | 96.62 | |
| d2huga1 | 55 | CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId | 96.16 | |
| d2dy8a1 | 69 | ATP-dependent helicase CHD1 (Chromo domain protein | 95.77 | |
| d2b2ya1 | 80 | ATP-dependent helicase CHD1 (Chromo domain protein | 95.39 | |
| d2dy7a1 | 81 | ATP-dependent helicase CHD1 (Chromo domain protein | 90.27 | |
| d2dy7a1 | 81 | ATP-dependent helicase CHD1 (Chromo domain protein | 82.88 | |
| d2b2ya2 | 95 | ATP-dependent helicase CHD1 (Chromo domain protein | 81.22 |
| >d2fmma1 b.34.13.2 (A:108-175) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: SH3-like barrel superfamily: Chromo domain-like family: Chromo domain domain: Heterochromatin protein 1, HP1 species: Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]
Probab=99.96 E-value=1.3e-30 Score=189.63 Aligned_cols=67 Identities=42% Similarity=0.640 Sum_probs=64.9
Q ss_pred ccCCCCCCCCcccceeeeeeeCCceEEEEEeCCCCCcceeehhHHHhhCCHHHHHHHHhhccCCCCC
Q psy8405 150 DMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPSEN 216 (225)
Q Consensus 150 ~~~~GF~RGLepEkIIGatd~~GeL~FLVKWKg~de~DlVpA~eaneKcPQmVIkFYEerL~w~~~~ 216 (225)
++|+||+|||+||+|+|+|+.+|+|||||||||++++|+||+.+|+.+||||||+|||+||+|++++
T Consensus 1 ~~p~Gf~RGl~~ekIig~t~~~gel~flvkwk~~d~~dlVp~~~a~~~~Pq~VI~fYE~rl~w~~~~ 67 (68)
T d2fmma1 1 EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYP 67 (68)
T ss_dssp CCCCGGGGCCCEEEEEEEEEETTEEEEEEEETTCSCCEEEEHHHHHHHCHHHHHHHHHTTEEESSCC
T ss_pred CCCcccccCCCccEEEEeEccCCeEEEEEEECCCChhhheeHHHHHHhCCHHHHHHHHHhcccCCCC
Confidence 4689999999999999999999999999999999999999999999999999999999999999875
|
| >d1e0ba_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d3deoa1 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|