Psyllid ID: psy8405


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MALLKMELLGIGPFPKKRGRKRKHFSVVAEQKDLSQQSNENNQGLKSGDHENIHNVNTSKIGIKTEENPTLDGGNIKIPKKRGRKRKYPLANLIQPTSNHTPDGTVVKKKRGRKRKYPLPTVEPEEVAYKGSQHNNSVNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPSENNASKQSSSQ
cccHHHHHccccccccccccccccccEEEEEcccHHHHHcccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHccccccccccHHHHHHHHHccccccccccccccEEEcEEEEccEEEEEEEEcccccccEEcHHHHHHHccHHHHHHHHHHcccccccccccccccc
cHHHHHHHHcccccccccccccccEEEEEEcccHcccccccccccccccccccccccHHHHHHHHHHccccccccccccHHccccccccccccccccHccccHHHHHHHcccHHHccccccccccccccccccccccccccHHHHHccccccccccccccHHHEEccccccccEEEEEEEccccccccccHHHHHcccccEEEEEEHHHccccccccHHHccccc
MALLKMELlgigpfpkkrgrkrkhfSVVAeqkdlsqqsnennqglksgdhenihnvntskigikteenptldggnikipkkrgrkrkyplanliqptsnhtpdgtvvkkkrgrkrkyplptvepeevaykgsqhnnsvnDIVVKEKLLndmnlgidrnlpveEIIGATIEVGFPAYLVtwegsdeadllpaeickrkypqpliRFFEQhlvfpsennaskqsssq
mallkmellgigpfpkkrgrkrKHFSVvaeqkdlsqqsnennqglksgdhenihNVNTSkigikteenptldggnikipkkrgrkRKYPlanliqptsnhtpdgtvvkkkrgrkrkyplptvepeevaykgsqhnnsvnDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQhlvfpsennaskqsssq
MALLKMELLGIGPFPkkrgrkrkHFSVVAEQKDLSQQSNENNQGLKSGDHENIHNVNTSKIGIKTEENPTLDggnikipkkrgrkrkYPLANLIQPTSNHTPDGTVVkkkrgrkrkYPLPTVEPEEVAYKGSQHNNSVNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPSENNASKQSSSQ
*****************************************************************************************************************************************VNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVF*************
***LK*ELLGIG*************************************************************************************SNHTPDGTVV**************************************************NLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLV**************
MALLKMELLGIGPFPKK********SVVAEQKDLSQQSNENNQGLKSGDHENIHNVNTSKIGIKTEENPTLDGGNIKIPKKRGRKRKYPLANLIQPTSNHTP***************PLPTVEPEEVAYKGSQHNNSVNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPS***********
MALLKMELLGIGPFPKKRGRKRKHFSVVAEQKDLS***************ENIHNVNTSKIGIKTEENP*****NIKIPK************LI*********************************************************NLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPS***********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALLKMELLGIGPFPKKRGRKRKHFSVVAEQKDLSQQSNENNQGLKSGDHENIHNVNTSKIGIKTEENPTLDGGNIKIPKKRGRKRKYPLANLIQPTSNHTPDGTVVKKKRGRKRKYPLPTVEPEEVAYKGSQHNNSVNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPSENNASKQSSSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q61686191 Chromobox protein homolog yes N/A 0.36 0.424 0.409 3e-09
P45973191 Chromobox protein homolog yes N/A 0.4 0.471 0.391 4e-09
P29227213 Heterochromatin protein 1 N/A N/A 0.28 0.295 0.380 9e-08
P83917185 Chromobox protein homolog no N/A 0.275 0.335 0.461 2e-07
P83916185 Chromobox protein homolog no N/A 0.275 0.335 0.461 2e-07
P05205206 Heterochromatin protein 1 no N/A 0.288 0.315 0.338 1e-06
Q5R6X7183 Chromobox protein homolog no N/A 0.271 0.333 0.442 4e-06
Q13185183 Chromobox protein homolog no N/A 0.271 0.333 0.442 4e-06
P23198183 Chromobox protein homolog no N/A 0.271 0.333 0.442 4e-06
>sp|Q61686|CBX5_MOUSE Chromobox protein homolog 5 OS=Mus musculus GN=Cbx5 PE=1 SV=1 Back     alignment and function desciption
 Score = 62.0 bits (149), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/83 (40%), Positives = 50/83 (60%), Gaps = 2/83 (2%)

Query: 132 SQHNNSVNDIVVKEKL--LNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLL 189
           S  +NS +DI  K+K    ND+  G +R L  E+IIGAT   G   +L+ W+ +DEADL+
Sbjct: 92  SSFSNSADDIKSKKKREQSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLV 151

Query: 190 PAEICKRKYPQPLIRFFEQHLVF 212
            A+    K PQ +I F+E+ L +
Sbjct: 152 LAKEANVKCPQIVIAFYEERLTW 174




Component of heterochromatin that recognizes and binds histone H3 tails methylated at 'Lys-9' (H3K9me), leading to epigenetic repression. In contrast, it is excluded from chromatin when 'Tyr-41' of histone H3 is phosphorylated (H3Y41ph). Can interact with lamin-B receptor (LBR). This interaction can contribute to the association of the heterochromatin with the inner nuclear membrane. Involved in the formation of functional kinetochore through interaction with MIS12 complex proteins.
Mus musculus (taxid: 10090)
>sp|P45973|CBX5_HUMAN Chromobox protein homolog 5 OS=Homo sapiens GN=CBX5 PE=1 SV=1 Back     alignment and function description
>sp|P29227|HP1_DROVI Heterochromatin protein 1 OS=Drosophila virilis GN=Su(var)205 PE=3 SV=1 Back     alignment and function description
>sp|P83917|CBX1_MOUSE Chromobox protein homolog 1 OS=Mus musculus GN=Cbx1 PE=1 SV=1 Back     alignment and function description
>sp|P83916|CBX1_HUMAN Chromobox protein homolog 1 OS=Homo sapiens GN=CBX1 PE=1 SV=1 Back     alignment and function description
>sp|P05205|HP1_DROME Heterochromatin protein 1 OS=Drosophila melanogaster GN=Su(var)205 PE=1 SV=2 Back     alignment and function description
>sp|Q5R6X7|CBX3_PONAB Chromobox protein homolog 3 OS=Pongo abelii GN=CBX3 PE=2 SV=1 Back     alignment and function description
>sp|Q13185|CBX3_HUMAN Chromobox protein homolog 3 OS=Homo sapiens GN=CBX3 PE=1 SV=4 Back     alignment and function description
>sp|P23198|CBX3_MOUSE Chromobox protein homolog 3 OS=Mus musculus GN=Cbx3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
225714588201 Chromobox protein homolog 1 [Lepeophthei 0.373 0.417 0.404 2e-09
225714180199 Chromobox protein homolog 1 [Lepeophthei 0.36 0.407 0.419 2e-09
225713868202 Chromobox protein homolog 1 [Lepeophthei 0.373 0.415 0.404 2e-09
225712476202 Chromobox protein homolog 1 [Lepeophthei 0.373 0.415 0.404 2e-09
225712178201 Chromobox protein homolog 1 [Lepeophthei 0.373 0.417 0.404 2e-09
290561793202 Chromobox protein homolog 1 [Lepeophthei 0.373 0.415 0.404 2e-09
290462581203 Chromobox protein homolog 1 [Lepeophthei 0.373 0.413 0.404 2e-09
225713332203 Chromobox protein homolog 1 [Lepeophthei 0.373 0.413 0.404 2e-09
225712384203 Chromobox protein homolog 1 [Lepeophthei 0.373 0.413 0.404 2e-09
225712028203 Chromobox protein homolog 1 [Lepeophthei 0.373 0.413 0.404 3e-09
>gi|225714588|gb|ACO13140.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
 Score = 68.9 bits (167), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 49/84 (58%)

Query: 133 QHNNSVNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAE 192
           +  +S N+     K  +D   G DRNL  E IIGAT   G   +L+ W+GSDEADL+PA 
Sbjct: 111 KSTSSSNEKSKSRKADDDRPRGFDRNLDPERIIGATDSSGELMFLIKWKGSDEADLVPAR 170

Query: 193 ICKRKYPQPLIRFFEQHLVFPSEN 216
               + PQ +I+F+E+ L + + N
Sbjct: 171 EANVRCPQTVIKFYEERLTWHTSN 194




Source: Lepeophtheirus salmonis

Species: Lepeophtheirus salmonis

Genus: Lepeophtheirus

Family: Caligidae

Order: Siphonostomatoida

Class: Maxillopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|225714180|gb|ACO12936.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|225713868|gb|ACO12780.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|225712476|gb|ACO12084.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|225712178|gb|ACO11935.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|290561793|gb|ADD38294.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|290462581|gb|ADD24338.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|225713332|gb|ACO12512.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|225712384|gb|ACO12038.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
>gi|225712028|gb|ACO11860.1| Chromobox protein homolog 1 [Lepeophtheirus salmonis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
UNIPROTKB|G3V1X9190 CBX5 "Chromobox protein homolo 0.448 0.531 0.367 9.4e-11
MGI|MGI:109372191 Cbx5 "chromobox 5" [Mus muscul 0.448 0.528 0.373 9.4e-11
RGD|1306619191 Cbx5 "chromobox homolog 5" [Ra 0.448 0.528 0.373 9.4e-11
UNIPROTKB|F2Z4J7191 CBX5 "Uncharacterized protein" 0.448 0.528 0.364 1.5e-10
UNIPROTKB|P45973191 CBX5 "Chromobox protein homolo 0.448 0.528 0.364 1.5e-10
UNIPROTKB|F2Z5T3191 LOC100519426 "Uncharacterized 0.448 0.528 0.364 1.5e-10
ZFIN|ZDB-GENE-030131-1158177 cbx3a "chromobox homolog 3a (H 0.408 0.519 0.387 1.5e-10
UNIPROTKB|E2QYK6191 CBX5 "Uncharacterized protein" 0.448 0.528 0.355 3.2e-10
UNIPROTKB|I3LQ28190 I3LQ28 "Uncharacterized protei 0.444 0.526 0.364 6.6e-10
UNIPROTKB|G5E6N7185 CBX1 "Uncharacterized protein" 0.36 0.437 0.392 1.4e-09
UNIPROTKB|G3V1X9 CBX5 "Chromobox protein homolog 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 150 (57.9 bits), Expect = 9.4e-11, P = 9.4e-11
 Identities = 39/106 (36%), Positives = 60/106 (56%)

Query:   123 EPEEVAYKGSQHNNSVNDIVVKEKL-LNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWE 181
             E  E   + S  +NS +DI  K+K   ND+  G +R L  E+IIGAT   G   +L+ W+
Sbjct:    83 EKSESNKRKSNFSNSADDIKSKKKRESNDIARGFERGLEPEKIIGATDSCGDLMFLMKWK 142

Query:   182 GSDEADLLPAEICKRKYPQPLIRFFEQHLV---FPSE-NNASKQSS 223
              +DEADL+ A+    K PQ +I F+E+ L    +P +  N  K+++
Sbjct:   143 DTDEADLVLAKEANVKCPQIVIAFYEERLTWHAYPEDAENKEKETA 188




GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
MGI|MGI:109372 Cbx5 "chromobox 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1306619 Cbx5 "chromobox homolog 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z4J7 CBX5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P45973 CBX5 "Chromobox protein homolog 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5T3 LOC100519426 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1158 cbx3a "chromobox homolog 3a (HP1 gamma homolog, Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2QYK6 CBX5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LQ28 I3LQ28 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G5E6N7 CBX1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
pfam0139357 pfam01393, Chromo_shadow, Chromo shadow domain 1e-08
smart0030061 smart00300, ChSh, Chromo Shadow Domain 2e-07
cd0003454 cd00034, ChSh, Chromo Shadow Domain, found in asso 1e-05
>gnl|CDD|201767 pfam01393, Chromo_shadow, Chromo shadow domain Back     alignment and domain information
 Score = 49.7 bits (119), Expect = 1e-08
 Identities = 23/56 (41%), Positives = 35/56 (62%), Gaps = 1/56 (1%)

Query: 157 RNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVF 212
           R L +E+I+GAT   G   +L  ++  DEADL+PA+    K PQ +I F+E+ L +
Sbjct: 1   RGLELEKIVGATDSPGELHFLCKFKD-DEADLVPAKEANVKCPQQVIAFYEERLTW 55


This domain is distantly related to pfam00385. This domain is always found in association with a chromo domain. Length = 57

>gnl|CDD|197638 smart00300, ChSh, Chromo Shadow Domain Back     alignment and domain information
>gnl|CDD|237998 cd00034, ChSh, Chromo Shadow Domain, found in association with N-terminal chromo (CHRromatin Organization MOdifier) domain; Chromo domains mediate the interaction of the heterochromatin with other heterochromatin proteins, thereby affecting chromatin structure (e Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
smart0030061 ChSh Chromo Shadow Domain. 99.92
PF0139358 Chromo_shadow: Chromo shadow domain Web page maint 99.91
cd0003454 ChSh Chromo Shadow Domain, found in association wi 99.84
KOG1911|consensus270 99.67
smart0029855 CHROMO Chromatin organization modifier domain. 98.27
PF0038555 Chromo: Chromo (CHRromatin Organisation MOdifier) 97.72
cd0002455 CHROMO Chromatin organization modifier (chromo) do 97.55
PF0038555 Chromo: Chromo (CHRromatin Organisation MOdifier) 96.28
KOG1911|consensus 270 96.25
cd0002455 CHROMO Chromatin organization modifier (chromo) do 94.16
KOG2748|consensus 369 93.06
KOG2748|consensus 369 92.4
smart0029855 CHROMO Chromatin organization modifier domain. 92.11
>smart00300 ChSh Chromo Shadow Domain Back     alignment and domain information
Probab=99.92  E-value=9.5e-26  Score=162.22  Aligned_cols=61  Identities=38%  Similarity=0.674  Sum_probs=59.3

Q ss_pred             CCCCCCCcccceeeeeeeCCceEEEEEeCCCCCcceeehhHHHhhCCHHHHHHHHhhccCCC
Q psy8405         153 LGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPS  214 (225)
Q Consensus       153 ~GF~RGLepEkIIGatd~~GeL~FLVKWKg~de~DlVpA~eaneKcPQmVIkFYEerL~w~~  214 (225)
                      .||+||+++|+|||+++.+|+|+|||+|+| +++++||+.+||.+|||+||+|||+||+|++
T Consensus         1 ~gf~~g~~~e~Ivg~~d~~G~l~flikwk~-~~~~lVp~~~~~~k~P~~vI~FYE~~l~~~~   61 (61)
T smart00300        1 KDEERGKSWEDIVGITKDDGELTFLIKWKD-DAASLVPNKEANVKCPQKVIRFYESHLTFQS   61 (61)
T ss_pred             CccccCCCHHHHhceecCCCeEEEEEEEeC-CcEEEEEHHHHHHHChHHHHHHHHHhCccCC
Confidence            389999999999999999999999999999 9999999999999999999999999999974



>PF01393 Chromo_shadow: Chromo shadow domain Web page maintained by Rein Aasland; InterPro: IPR008251 Chromo shadow domain is distantly related to chromo domain Back     alignment and domain information
>cd00034 ChSh Chromo Shadow Domain, found in association with N-terminal chromo (CHRromatin Organization MOdifier) domain; Chromo domains mediate the interaction of the heterochromatin with other heterochromatin proteins, thereby affecting chromatin structure (e Back     alignment and domain information
>KOG1911|consensus Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information
>PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation Back     alignment and domain information
>KOG1911|consensus Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>KOG2748|consensus Back     alignment and domain information
>KOG2748|consensus Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
1s4z_A75 Hp1 Chromo Shadow Domain In Complex With Pxvxl Moti 6e-08
3q6s_A78 The Crystal Structure Of The Heterochromatin Protei 6e-08
3p7j_A87 Drosophila Hp1a Chromo Shadow Domain Length = 87 7e-08
3i3c_A75 Crystal Structural Of Cbx5 Chromo Shadow Domain Len 7e-08
2fmm_A74 Crystal Structure Of Emsy-Hp1 Complex Length = 74 3e-07
1dz1_A70 Mouse Hp1 (M31) C Terminal (Shadow Chromo) Domain L 3e-07
3kup_A65 Crystal Structure Of The Cbx3 Chromo Shadow Domain 2e-06
>pdb|1S4Z|A Chain A, Hp1 Chromo Shadow Domain In Complex With Pxvxl Motif Of Caf- 1 Length = 75 Back     alignment and structure

Iteration: 1

Score = 54.3 bits (129), Expect = 6e-08, Method: Compositional matrix adjust. Identities = 28/61 (45%), Positives = 37/61 (60%) Query: 154 GIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFP 213 G R L E IIGAT G +L+ W+ SDEADL+PA+ K PQ +I F+E+ L + Sbjct: 11 GFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWH 70 Query: 214 S 214 S Sbjct: 71 S 71
>pdb|3Q6S|A Chain A, The Crystal Structure Of The Heterochromatin Protein 1 Beta Chromoshadow Domain Complexed With A Peptide From Shugoshin 1 Length = 78 Back     alignment and structure
>pdb|3P7J|A Chain A, Drosophila Hp1a Chromo Shadow Domain Length = 87 Back     alignment and structure
>pdb|3I3C|A Chain A, Crystal Structural Of Cbx5 Chromo Shadow Domain Length = 75 Back     alignment and structure
>pdb|2FMM|A Chain A, Crystal Structure Of Emsy-Hp1 Complex Length = 74 Back     alignment and structure
>pdb|1DZ1|A Chain A, Mouse Hp1 (M31) C Terminal (Shadow Chromo) Domain Length = 70 Back     alignment and structure
>pdb|3KUP|A Chain A, Crystal Structure Of The Cbx3 Chromo Shadow Domain Length = 65 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3i3c_A75 Chromobox protein homolog 5; CBX5, chromo shadow d 8e-17
3kup_A65 Chromobox protein homolog 3; chromo shadow domain, 1e-16
3q6s_A78 Chromobox protein homolog 1; incenp, heterochromat 1e-16
2fmm_A74 Chromobox protein homolog 1; ENT domain, chromo sh 2e-16
3p7j_A87 Heterochromatin protein 1; chromo shadow domain, g 4e-16
>3i3c_A Chromobox protein homolog 5; CBX5, chromo shadow domain, structural genomics, structural consortium, SGC, centromere, nucleus, phosphoprotein; 2.48A {Homo sapiens} Length = 75 Back     alignment and structure
 Score = 71.4 bits (175), Expect = 8e-17
 Identities = 28/74 (37%), Positives = 42/74 (56%)

Query: 137 SVNDIVVKEKLLNDMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKR 196
           S     +  +  ND+  G +R L  E+IIGAT   G   +L+ W+ +DEADL+ A+    
Sbjct: 1   SSGRENLYFQGSNDIARGFERGLEPEKIIGATDSCGDLMFLMKWKDTDEADLVLAKEANV 60

Query: 197 KYPQPLIRFFEQHL 210
           K PQ +I F+E+ L
Sbjct: 61  KCPQIVIAFYEERL 74


>3kup_A Chromobox protein homolog 3; chromo shadow domain, structural genomics consortium, SGC, acetylation, chromatin regulator, nucleus, phosphoprotein; 1.77A {Homo sapiens} PDB: 1dz1_A Length = 65 Back     alignment and structure
>3q6s_A Chromobox protein homolog 1; incenp, heterochromatin, centromere, cell cycle; 1.93A {Homo sapiens} Length = 78 Back     alignment and structure
>2fmm_A Chromobox protein homolog 1; ENT domain, chromo shadow domain, EMSY protein, heterochroma protein 1, transcription; 1.80A {Homo sapiens} SCOP: b.34.13.2 PDB: 1s4z_A Length = 74 Back     alignment and structure
>3p7j_A Heterochromatin protein 1; chromo shadow domain, gene silenc epigenetics, transcription; 2.30A {Drosophila melanogaster} Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
3q6s_A78 Chromobox protein homolog 1; incenp, heterochromat 99.96
2fmm_A74 Chromobox protein homolog 1; ENT domain, chromo sh 99.95
3p7j_A87 Heterochromatin protein 1; chromo shadow domain, g 99.95
3kup_A65 Chromobox protein homolog 3; chromo shadow domain, 99.94
3i3c_A75 Chromobox protein homolog 5; CBX5, chromo shadow d 99.93
1e0b_A68 SWI6 protein; chromatin-binding, chromodomain, sha 99.83
2h1e_A177 Chromo domain protein 1; CHD1, tandem chromodomain 98.8
3fdt_A59 Chromobox protein homolog 5; chromobox homolog5, C 98.54
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 98.52
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 98.48
3g7l_A61 Chromo domain-containing protein 1; chromodomain, 98.45
3lwe_A62 M-phase phosphoprotein 8; MPP8, structural genomic 98.41
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 98.37
1ap0_A73 Modifier protein 1; chromatin-binding, protein int 98.36
3h91_A54 Chromobox protein homolog 2; human chromobox homol 98.34
1ap0_A73 Modifier protein 1; chromatin-binding, protein int 98.25
1q3l_A69 Heterochromatin protein 1; chromodomain, HP1, chro 98.23
1pfb_A55 Polycomb protein; chromatin, histone methylation, 98.2
3f2u_A55 Chromobox protein homolog 1; human chromobox homol 98.17
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 98.17
3fdt_A59 Chromobox protein homolog 5; chromobox homolog5, C 98.13
2rso_A92 Chromatin-associated protein SWI6; chromodomain, s 98.13
2dnv_A64 Chromobox protein homolog 8; chromo domain, histon 98.13
2k1b_A73 Chromobox protein homolog 7; alpha/beta protein, c 98.13
3mts_A64 Histone-lysine N-methyltransferase SUV39H1; histon 98.12
1g6z_A70 CLR4 protein; transferase; NMR {Schizosaccharomyce 98.07
1pfb_A55 Polycomb protein; chromatin, histone methylation, 98.06
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 98.03
1pdq_A72 Polycomb protein; methyllysine, chromodomain, poly 98.01
1g6z_A70 CLR4 protein; transferase; NMR {Schizosaccharomyce 98.01
2k1b_A73 Chromobox protein homolog 7; alpha/beta protein, c 98.0
1q3l_A69 Heterochromatin protein 1; chromodomain, HP1, chro 98.0
2d9u_A74 Chromobox protein homolog 2 (isoform 2); chromobox 98.0
2dnt_A78 Chromodomain protein, Y chromosome-like, isoform B 97.99
2kvm_A74 Chromobox protein homolog 7; histone modification, 97.97
3h91_A54 Chromobox protein homolog 2; human chromobox homol 97.96
2dnv_A64 Chromobox protein homolog 8; chromo domain, histon 97.96
3g7l_A61 Chromo domain-containing protein 1; chromodomain, 97.92
3lwe_A62 M-phase phosphoprotein 8; MPP8, structural genomic 97.83
2rsn_A75 Chromo domain-containing protein 1; chromodomain, 97.83
2rso_A92 Chromatin-associated protein SWI6; chromodomain, s 97.8
2b2y_A187 CHD-1, chromodomain-helicase-DNA-binding protein 1 97.8
2kvm_A74 Chromobox protein homolog 7; histone modification, 97.75
4hae_A81 CDY-like 2, chromodomain Y-like protein 2; protein 97.74
2dnt_A78 Chromodomain protein, Y chromosome-like, isoform B 97.73
2rsn_A75 Chromo domain-containing protein 1; chromodomain, 97.71
2d9u_A74 Chromobox protein homolog 2 (isoform 2); chromobox 97.52
1x3p_A54 Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot 97.52
1x3p_A54 Cpsrp43; chromo-2 domain, chloroplasts, LHCP, prot 97.48
4hae_A81 CDY-like 2, chromodomain Y-like protein 2; protein 97.39
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 97.26
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 96.91
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 96.83
2epb_A68 Chromodomain-helicase-DNA-binding protein 6; struc 96.44
2b2y_C115 CHD-1, chromodomain-helicase-DNA-binding protein 1 95.44
2b2y_A187 CHD-1, chromodomain-helicase-DNA-binding protein 1 94.3
2b2y_C115 CHD-1, chromodomain-helicase-DNA-binding protein 1 93.93
2ee1_A64 Chromodomain helicase-DNA-binding protein 4; EC 3. 93.88
2h1e_A177 Chromo domain protein 1; CHD1, tandem chromodomain 91.09
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 85.23
>3q6s_A Chromobox protein homolog 1; incenp, heterochromatin, centromere, cell cycle; 1.93A {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
Probab=99.96  E-value=8.1e-30  Score=191.01  Aligned_cols=72  Identities=39%  Similarity=0.609  Sum_probs=64.9

Q ss_pred             ccCCCCCCCCcccceeeeeeeCCceEEEEEeCCCCCcceeehhHHHhhCCHHHHHHHHhhccCCCCCchhhh
Q psy8405         150 DMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPSENNASKQ  221 (225)
Q Consensus       150 ~~~~GF~RGLepEkIIGatd~~GeL~FLVKWKg~de~DlVpA~eaneKcPQmVIkFYEerL~w~~~~~~~~q  221 (225)
                      ++++||+|||+||+|||+++.+|+|+|||||||++++|+||+.+||.+||||||+|||+||+|+++++++.+
T Consensus         1 ~k~~Gf~rGle~EkI~g~~~~~Gel~fLvKWKg~~~~dlVpa~ean~k~PqlVI~FYE~~l~~~~~~~~~~~   72 (78)
T 3q6s_A            1 EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDD   72 (78)
T ss_dssp             -CCCGGGGCCCEEEEEEEECTTSSCEEEEEETTCSCEEEEEHHHHHHHSHHHHHHHHHTTEEEECCC-----
T ss_pred             CCCCccccCCCceEEeeEEcCCCcEEEEEEECCCChhheEeHHHHHhhChHHHHHHHHHhcccccCCchhhh
Confidence            368999999999999999999999999999999999999999999999999999999999999998877644



>2fmm_A Chromobox protein homolog 1; ENT domain, chromo shadow domain, EMSY protein, heterochroma protein 1, transcription; 1.80A {Homo sapiens} SCOP: b.34.13.2 PDB: 1s4z_A Back     alignment and structure
>3p7j_A Heterochromatin protein 1; chromo shadow domain, gene silenc epigenetics, transcription; 2.30A {Drosophila melanogaster} Back     alignment and structure
>3kup_A Chromobox protein homolog 3; chromo shadow domain, structural genomics consortium, SGC, acetylation, chromatin regulator, nucleus, phosphoprotein; 1.77A {Homo sapiens} SCOP: b.34.13.2 PDB: 1dz1_A Back     alignment and structure
>3i3c_A Chromobox protein homolog 5; CBX5, chromo shadow domain, structural genomics, structural consortium, SGC, centromere, nucleus, phosphoprotein; 2.48A {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>1e0b_A SWI6 protein; chromatin-binding, chromodomain, shadow, heterochromatin; HET: 1PG; 1.9A {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Back     alignment and structure
>3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Back     alignment and structure
>3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* Back     alignment and structure
>1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Back     alignment and structure
>3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A Back     alignment and structure
>1ap0_A Modifier protein 1; chromatin-binding, protein interaction motif, alpha+beta; NMR {Mus musculus} SCOP: b.34.13.2 PDB: 1guw_A* Back     alignment and structure
>1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>3f2u_A Chromobox protein homolog 1; human chromobox homolog 1, CBX1, structural genomics, struct genomics consortium, SGC, centromere, nucleus; 1.80A {Homo sapiens} PDB: 3tzd_A* 2l11_A* 3dm1_A* Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>3fdt_A Chromobox protein homolog 5; chromobox homolog5, CBX5, structural GENO structural genomics consortium, SGC, centromere, nucleus, phosphoprotein; HET: M3L; 2.00A {Homo sapiens} Back     alignment and structure
>2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Back     alignment and structure
>2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Back     alignment and structure
>3mts_A Histone-lysine N-methyltransferase SUV39H1; histone methyltransferase, histone-lysine N-methyltransferas SUV39H1, histone H3, TRI-methylation; 2.20A {Homo sapiens} Back     alignment and structure
>1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* Back     alignment and structure
>1pdq_A Polycomb protein; methyllysine, chromodomain, polycomb, lysine methylation, trimethyllysine, cation-PI, chromo, structural protein; HET: M3L; 1.76A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>1g6z_A CLR4 protein; transferase; NMR {Schizosaccharomyces pombe} SCOP: b.34.13.2 Back     alignment and structure
>2k1b_A Chromobox protein homolog 7; alpha/beta protein, chromatin regulator, nucleus, repressor, transcription, transcription regulation; NMR {Homo sapiens} PDB: 2l12_A* 2l1b_A* Back     alignment and structure
>1q3l_A Heterochromatin protein 1; chromodomain, HP1, chromatin, methyllysine, monomethyllysine, structural protein; HET: MLZ; 1.64A {Drosophila melanogaster} SCOP: b.34.13.2 PDB: 1kne_A* 1kna_A* Back     alignment and structure
>2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Back     alignment and structure
>3h91_A Chromobox protein homolog 2; human chromobox homolog 2, CBX2, structural genomics, structural genomics consortium, SGC, chromatin regulator, D binding, nucleus; HET: M3L; 1.50A {Homo sapiens} SCOP: b.34.13.2 PDB: 2k28_A 3i8z_A Back     alignment and structure
>2dnv_A Chromobox protein homolog 8; chromo domain, histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.34.13.2 Back     alignment and structure
>3g7l_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, silencing, cell cycle, chromosome partition, DNA-binding, nucleus; HET: M3L; 2.20A {Schizosaccharomyces pombe} Back     alignment and structure
>3lwe_A M-phase phosphoprotein 8; MPP8, structural genomics, structural genomics consortium, S repeat, nucleus, cell cycle; 2.05A {Homo sapiens} SCOP: b.34.13.0 PDB: 3r93_A* 3svm_A* 3qo2_A* Back     alignment and structure
>2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2rso_A Chromatin-associated protein SWI6; chromodomain, silencing, chromosomal protein, Met transcription; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* Back     alignment and structure
>2kvm_A Chromobox protein homolog 7; histone modification, lysine methylation, chromobox, polycom chromatin-binding; HET: MLY; NMR {Mus musculus} Back     alignment and structure
>4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} Back     alignment and structure
>2dnt_A Chromodomain protein, Y chromosome-like, isoform B; histone H3 tail, choromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.34.13.2 Back     alignment and structure
>2rsn_A Chromo domain-containing protein 1; chromodomain, protein-peptide complex, RNA-mediated gene SIL chromosomal protein, methylation; HET: M3L; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2d9u_A Chromobox protein homolog 2 (isoform 2); chromobox homolog 2, chromo domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 Back     alignment and structure
>1x3p_A Cpsrp43; chromo-2 domain, chloroplasts, LHCP, protein translocation, unknown function; NMR {Arabidopsis thaliana} SCOP: b.34.13.2 Back     alignment and structure
>4hae_A CDY-like 2, chromodomain Y-like protein 2; protein binding, structural genomics consortiu; 2.00A {Homo sapiens} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Back     alignment and structure
>2epb_A Chromodomain-helicase-DNA-binding protein 6; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C Back     alignment and structure
>2b2y_A CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 b.34.13.2 PDB: 2b2u_A* 2b2v_A* 2b2w_A 2b2t_A* Back     alignment and structure
>2b2y_C CHD-1, chromodomain-helicase-DNA-binding protein 1; three stranded antiparallel beta sheet, alpha helix linker, peptide binding protein; 2.35A {Homo sapiens} SCOP: b.34.13.2 PDB: 2b2u_C* 2b2v_C* 2b2t_C* 2b2w_C Back     alignment and structure
>2ee1_A Chromodomain helicase-DNA-binding protein 4; EC 3.6.1.-, ATP- dependent helicase CHD4, CHD-4, MI-2 autoantigen 218 kDa protein, MI2-beta; NMR {Homo sapiens} Back     alignment and structure
>2h1e_A Chromo domain protein 1; CHD1, tandem chromodomains, three-stranded ANT B-sheet, hydrolase; 2.20A {Saccharomyces cerevisiae} PDB: 2dy7_A 2dy8_A Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d2fmma168 b.34.13.2 (A:108-175) Heterochromatin protein 1, H 9e-19
>d2fmma1 b.34.13.2 (A:108-175) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Length = 68 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: Chromo domain-like
family: Chromo domain
domain: Heterochromatin protein 1, HP1
species: Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]
 Score = 75.1 bits (185), Expect = 9e-19
 Identities = 28/64 (43%), Positives = 38/64 (59%)

Query: 154 GIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFP 213
           G  R L  E IIGAT   G   +L+ W+ SDEADL+PA+    K PQ +I F+E+ L + 
Sbjct: 5   GFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWH 64

Query: 214 SENN 217
           S  +
Sbjct: 65  SYPS 68


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d2fmma168 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 99.96
d1e0ba_61 Heterochromatin protein 1, HP1 {Fission yeast (Sch 99.03
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 98.18
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 98.1
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 98.06
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 98.06
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 97.96
d1guwa_73 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 97.95
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 97.93
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 97.88
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 97.84
d1guwa_73 Heterochromatin protein 1, HP1 {Mouse (Mus musculu 97.84
d1g6za_70 Histone methyltransferase clr4, chromo domain {Fis 97.69
d1g6za_70 Histone methyltransferase clr4, chromo domain {Fis 97.59
d2dy8a169 ATP-dependent helicase CHD1 (Chromo domain protein 97.58
d2b2ya180 ATP-dependent helicase CHD1 (Chromo domain protein 97.51
d1x3pa154 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 97.37
d1x3pa154 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 97.27
d3deoa144 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 96.62
d2huga155 CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId 96.16
d2dy8a169 ATP-dependent helicase CHD1 (Chromo domain protein 95.77
d2b2ya180 ATP-dependent helicase CHD1 (Chromo domain protein 95.39
d2dy7a181 ATP-dependent helicase CHD1 (Chromo domain protein 90.27
d2dy7a181 ATP-dependent helicase CHD1 (Chromo domain protein 82.88
d2b2ya295 ATP-dependent helicase CHD1 (Chromo domain protein 81.22
>d2fmma1 b.34.13.2 (A:108-175) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: Chromo domain-like
family: Chromo domain
domain: Heterochromatin protein 1, HP1
species: Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]
Probab=99.96  E-value=1.3e-30  Score=189.63  Aligned_cols=67  Identities=42%  Similarity=0.640  Sum_probs=64.9

Q ss_pred             ccCCCCCCCCcccceeeeeeeCCceEEEEEeCCCCCcceeehhHHHhhCCHHHHHHHHhhccCCCCC
Q psy8405         150 DMNLGIDRNLPVEEIIGATIEVGFPAYLVTWEGSDEADLLPAEICKRKYPQPLIRFFEQHLVFPSEN  216 (225)
Q Consensus       150 ~~~~GF~RGLepEkIIGatd~~GeL~FLVKWKg~de~DlVpA~eaneKcPQmVIkFYEerL~w~~~~  216 (225)
                      ++|+||+|||+||+|+|+|+.+|+|||||||||++++|+||+.+|+.+||||||+|||+||+|++++
T Consensus         1 ~~p~Gf~RGl~~ekIig~t~~~gel~flvkwk~~d~~dlVp~~~a~~~~Pq~VI~fYE~rl~w~~~~   67 (68)
T d2fmma1           1 EKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYP   67 (68)
T ss_dssp             CCCCGGGGCCCEEEEEEEEEETTEEEEEEEETTCSCCEEEEHHHHHHHCHHHHHHHHHTTEEESSCC
T ss_pred             CCCcccccCCCccEEEEeEccCCeEEEEEEECCCChhhheeHHHHHHhCCHHHHHHHHHhcccCCCC
Confidence            4689999999999999999999999999999999999999999999999999999999999999875



>d1e0ba_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fission yeast (Schizosaccharomyces pombe), SWI6 [TaxId: 4896]} Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guwa_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Mouse (Mus musculus), HP1 beta (MOD1, M31) [TaxId: 10090]} Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1g6za_ b.34.13.2 (A:) Histone methyltransferase clr4, chromo domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x3pa1 b.34.13.2 (A:1-54) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3deoa1 b.34.13.2 (A:85-128) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2huga1 b.34.13.2 (A:3-57) CpSRP43 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dy8a1 b.34.13.2 (A:279-347) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2ya1 b.34.13.2 (A:108-187) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dy7a1 b.34.13.2 (A:172-252) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b2ya2 b.34.13.2 (A:13-107) ATP-dependent helicase CHD1 (Chromo domain protein 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure