Diaphorina citri psyllid: psy8407

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90--
MKCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLIAYLEQASK
ccccccccccccccccccccccccccccccccccccccHHHHHccccccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcc
MKCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLIAYLEQAS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCAQCHTIEAGGAHKVGPNLHGLIGRKTGQAPGFSYTEANIKKGITWNKDTLFEYLENPKKYIPGTKMIFAGIKKPQERGDLIAYLEQASK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.very confidentP00004
Cytochrome c Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain.very confidentP67882
Cytochrome c Plays a role in apoptosis. Suppression of the anti-apoptotic members or activation of the pro-apoptotic members of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.very confidentP00002

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043231 [CC]intracellular membrane-bounded organellevery confidentGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003674 [MF]molecular_functionvery confident
GO:0044444 [CC]cytoplasmic partvery confidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005829 [CC]cytosolconfidentGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0020037 [MF]heme bindingconfidentGO:0005488, GO:0097159, GO:0003674, GO:1901363, GO:0046906
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006979 [BP]response to oxidative stressconfidentGO:0006950, GO:0008150, GO:0050896
GO:0006122 [BP]mitochondrial electron transport, ubiquinol to cytochrome cconfidentGO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0042743 [BP]hydrogen peroxide metabolic processconfidentGO:0008152, GO:0009987, GO:0008150, GO:0044237, GO:0072593
GO:0006123 [BP]mitochondrial electron transport, cytochrome c to oxygenconfidentGO:0044710, GO:0015980, GO:0006793, GO:0016310, GO:0009987, GO:0044237, GO:0006796, GO:0022900, GO:0045333, GO:0008152, GO:0022904, GO:0008150, GO:0006091, GO:0042775, GO:0042773, GO:0055114, GO:0006119
GO:0045155 [MF]electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activityconfidentGO:0003674, GO:0009055
GO:0044281 [BP]small molecule metabolic processconfidentGO:0044710, GO:0008150, GO:0008152
GO:0006309 [BP]apoptotic DNA fragmentationconfidentGO:0006921, GO:0097194, GO:0090304, GO:0090305, GO:0034641, GO:0030262, GO:0007569, GO:0044699, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071840, GO:0016043, GO:0006308, GO:0008150, GO:0071704, GO:1901360, GO:0010259, GO:0009987, GO:0044238, GO:0006915, GO:0006725, GO:0046700, GO:0006259, GO:0044763, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0046483, GO:0044248, GO:0044270, GO:0012501, GO:0000737, GO:0044237, GO:0043170, GO:0006807, GO:0019439, GO:0022411
GO:0034349 [BP]glial cell apoptotic processconfidentGO:0010259, GO:0009987, GO:0006915, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0097285, GO:0044699
GO:0070469 [CC]respiratory chainconfidentGO:0005575, GO:0044425, GO:0016020
GO:0004722 [MF]protein serine/threonine phosphatase activityconfidentGO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0000159 [CC]protein phosphatase type 2A complexconfidentGO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005506 [MF]iron ion bindingconfidentGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0005507 [MF]copper ion bindingconfidentGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0008289 [MF]lipid bindingconfidentGO:0003674, GO:0005488
GO:0008635 [BP]activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome cconfidentGO:0019222, GO:2001056, GO:0007569, GO:0010941, GO:0042981, GO:0050789, GO:0044699, GO:0097202, GO:0051345, GO:2000116, GO:0052547, GO:0043067, GO:0065007, GO:0043085, GO:0044093, GO:0043281, GO:0043280, GO:0065009, GO:0010259, GO:0009987, GO:0006919, GO:0052548, GO:0006915, GO:0050794, GO:0012501, GO:0044763, GO:0010950, GO:0010952, GO:0051336, GO:0050790, GO:0008150
GO:0005743 [CC]mitochondrial inner membraneconfidentGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005515 [MF]protein bindingconfidentGO:0003674, GO:0005488
GO:0042597 [CC]periplasmic spaceconfidentGO:0005575, GO:0044464, GO:0005623
GO:0043065 [BP]positive regulation of apoptotic processconfidentGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0005758 [CC]mitochondrial intermembrane spaceconfidentGO:0005737, GO:0005575, GO:0043231, GO:0043229, GO:0031970, GO:0044464, GO:0044444, GO:0005739, GO:0031975, GO:0044446, GO:0005740, GO:0031967, GO:0031974, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0044429
GO:0007291 [BP]sperm individualizationprobableGO:0048610, GO:0048232, GO:0007286, GO:0048468, GO:0019953, GO:0032501, GO:0009653, GO:0007275, GO:0044699, GO:0000003, GO:0048869, GO:0007349, GO:0007276, GO:0030855, GO:0002064, GO:0048515, GO:0032502, GO:0030154, GO:0048609, GO:0032504, GO:0060429, GO:0009888, GO:0044767, GO:0022414, GO:0007283, GO:0008150, GO:0022412, GO:0007281, GO:0044702, GO:0044707, GO:0003006, GO:0048856, GO:0048646, GO:0044763, GO:0009987
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0046669 [BP]regulation of compound eye retinal cell programmed cell deathprobableGO:0022603, GO:0050793, GO:0045595, GO:0060284, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0046668, GO:2000027, GO:0051239, GO:2000026, GO:0010941, GO:0050789
GO:0004114 [MF]3',5'-cyclic-nucleotide phosphodiesterase activityprobableGO:0016787, GO:0008081, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004112
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0005746 [CC]mitochondrial respiratory chainprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0040007 [BP]growthprobableGO:0008150
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0044351 [BP]macropinocytosisprobableGO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0040018 [BP]positive regulation of multicellular organism growthprobableGO:0040014, GO:0051240, GO:0050789, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0040008, GO:0045927

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I54, chain A
Confidence level:very confident
Coverage over the Query: 2-92
View the alignment between query and template
View the model in PyMOL