Diaphorina citri psyllid: psy8420


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MEDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIELHGTALDKTFK
cccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccHHHHHHcccccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHHHHHHccHHHHHHHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHccccccccc
*EDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIELHGTA******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIELHGTALDKTFK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein fem-1 homolog B Component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. Involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. Also involved in glucose homeostasis in pancreatic islet. Functions as an adapter/mediator in replication stress-induced signaling that leads to the activation of CHEK1.confidentQ9UK73
Protein fem-1 homolog B Component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. Involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. Also involved in glucose homeostasis in pancreatic islet. Functions as an adapter/mediator in replication stress-induced signaling that leads to the activation of CHEK1.confidentQ9Z2G0
Protein fem-1 homolog B Component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. Involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis.confidentQ5ZM55

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0050790 [BP]regulation of catalytic activityprobableGO:0008150, GO:0065009, GO:0065007, GO:0050789, GO:0019222
GO:0080134 [BP]regulation of response to stressprobableGO:0008150, GO:0065007, GO:0048583, GO:0050789
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0031399 [BP]regulation of protein modification processprobableGO:0032268, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0031323, GO:0050794, GO:0065007, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N11, chain A
Confidence level:very confident
Coverage over the Query: 6-157
View the alignment between query and template
View the model in PyMOL
Template: 3UTM, chain A
Confidence level:very confident
Coverage over the Query: 2-196
View the alignment between query and template
View the model in PyMOL