Psyllid ID: psy8420


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MEDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIELHGTALDKTFK
cccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccccccHHHHHHHccccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHHHHHHccHHHHHHHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccc
ccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccccEEEEEcccccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHcccccccHccHHHHHHHHHHccccccccccccccHHHHHccccHHHHHcHcccccHHHHHHHHHHHccccccccccHHHHHHHHHHcccHccccc
MEDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVnyetpvdtfhtndvckfpcaATTKLLIRCgadvnakdyqgntplHIIATYERAISDFQTLHTIILDLtengahmdtvnnkgltpiqatTTGVADLILRTLTKINLKCLAAKVItqnnitykglvphDLESFIELHGTALDKTFK
MEDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIElhgtaldktfk
MEDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIELHGTALDKTFK
****LVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIELHGTA******
*EDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIELHGTA******
MEDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIELHGTALDKTFK
MEDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIELHGTA******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPHDLESFIELHGTALDKTFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query199 2.2.26 [Sep-21-2011]
Q9Z2G0627 Protein fem-1 homolog B O yes N/A 0.939 0.298 0.518 9e-49
Q5ZM55627 Protein fem-1 homolog B O yes N/A 0.939 0.298 0.507 1e-48
Q6GPE5629 Protein fem-1 homolog B O N/A N/A 0.939 0.297 0.518 1e-48
P0C6P7627 Protein fem-1 homolog B O yes N/A 0.939 0.298 0.513 2e-48
Q9UK73627 Protein fem-1 homolog B O yes N/A 0.939 0.298 0.507 8e-48
A1ZBY1650 Protein fem-1 homolog B O yes N/A 0.929 0.284 0.406 3e-30
Q29RM5653 Protein fem-1 homolog A O no N/A 0.854 0.260 0.335 5e-20
Q9BSK4669 Protein fem-1 homolog A O no N/A 0.854 0.254 0.335 9e-20
Q6P9Z4617 Protein fem-1 homolog A O no N/A 0.773 0.249 0.355 1e-19
Q8C0T1654 Protein fem-1 homolog A-B no N/A 0.844 0.256 0.335 2e-19
>sp|Q9Z2G0|FEM1B_MOUSE Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 Back     alignment and function desciption
 Score =  192 bits (489), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 98/189 (51%), Positives = 128/189 (67%), Gaps = 2/189 (1%)

Query: 2   EDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPV 61
           E NL T LYL+ I TK     SEE++ RI K +++L  L   +R+  SLLHL VN  TPV
Sbjct: 441 ECNLYTFLYLVCISTKT--QCSEEDQCRINKQIYNLIHLDPRTREGFSLLHLAVNSNTPV 498

Query: 62  DTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILD 121
           D FHTNDVC FP A  TKLL+ CGA+VNA D +GN+ LHII  Y R ISDF TLH+II+ 
Sbjct: 499 DDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHSIIIS 558

Query: 122 LTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPH 181
           L E GAH D  N +  TP+  +TTGV++++L+T  K++LKCLAA+ +  N+I Y+  +P 
Sbjct: 559 LVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPR 618

Query: 182 DLESFIELH 190
            LE F+  H
Sbjct: 619 TLEEFVGFH 627




Component of an E3 ubiquitin-protein ligase complex, in which it may act as a substrate recognition subunit. Involved in apoptosis by acting as a death receptor-associated protein that mediates apoptosis. Also involved in glucose homeostasis in pancreatic islet. Functions as an adapter/mediator in replication stress-induced signaling that leads to the activation of CHEK1.
Mus musculus (taxid: 10090)
>sp|Q5ZM55|FEM1B_CHICK Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 Back     alignment and function description
>sp|Q6GPE5|FEM1B_XENLA Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 Back     alignment and function description
>sp|P0C6P7|FEM1B_RAT Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 Back     alignment and function description
>sp|Q9UK73|FEM1B_HUMAN Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 Back     alignment and function description
>sp|A1ZBY1|FEM1B_DROME Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 Back     alignment and function description
>sp|Q29RM5|FEM1A_BOVIN Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 Back     alignment and function description
>sp|Q9BSK4|FEM1A_HUMAN Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 Back     alignment and function description
>sp|Q6P9Z4|FEM1A_DANRE Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 Back     alignment and function description
>sp|Q8C0T1|FM1AB_MOUSE Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
375493328 642 fem-1 homolog B-like protein [Locusta mi 0.984 0.305 0.637 3e-70
242012572 626 predicted protein [Pediculus humanus cor 0.984 0.313 0.588 9e-65
332030425 643 Protein fem-1-like protein B [Acromyrmex 0.989 0.306 0.595 2e-61
307178909 653 Protein fem-1-like protein B [Camponotus 0.989 0.301 0.606 2e-61
229577406 650 feminization 1-like [Nasonia vitripennis 0.984 0.301 0.595 7e-61
91087297 643 PREDICTED: similar to fem-1 homolog b [T 0.889 0.275 0.604 2e-59
383858022 655 PREDICTED: protein fem-1 homolog B-like 0.984 0.299 0.57 3e-59
270009534 644 hypothetical protein TcasGA2_TC008808 [T 0.889 0.274 0.601 4e-58
307211423 653 Protein fem-1-like protein B [Harpegnath 0.874 0.266 0.603 2e-55
350401891 655 PREDICTED: protein fem-1 homolog B-like 0.969 0.294 0.583 3e-54
>gi|375493328|dbj|BAL61212.1| fem-1 homolog B-like protein [Locusta migratoria manilensis] Back     alignment and taxonomy information
 Score =  270 bits (689), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 125/196 (63%), Positives = 159/196 (81%)

Query: 1   MEDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETP 60
            E N+ T LY+LVI+TK++K  +++EE+R+  LV+ LNKL+VA+R+ ++LLHLCV+ ETP
Sbjct: 446 FESNITTVLYILVIITKLMKTCTKKEEFRVNSLVYRLNKLNVATREGKTLLHLCVDAETP 505

Query: 61  VDTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIIL 120
           VD FHTNDVCKFPCA T KLLI+CGADVNA D   NTPLH+I +Y++ ISDF TLH II+
Sbjct: 506 VDDFHTNDVCKFPCATTAKLLIQCGADVNAMDCNRNTPLHVIVSYQKPISDFLTLHAIIM 565

Query: 121 DLTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVP 180
           DLTE GAHMDTVNN G TP QA T+GVA++ILRT TK++LKC+AAK +   N+TY+G VP
Sbjct: 566 DLTEAGAHMDTVNNHGETPFQAATSGVAEIILRTQTKLSLKCMAAKAVKSFNLTYQGHVP 625

Query: 181 HDLESFIELHGTALDK 196
             LESFIELHG A+ +
Sbjct: 626 QSLESFIELHGPAVKQ 641




Source: Locusta migratoria manilensis

Species: Locusta migratoria

Genus: Locusta

Family: Acrididae

Order: Orthoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242012572|ref|XP_002427005.1| predicted protein [Pediculus humanus corporis] gi|212511243|gb|EEB14267.1| predicted protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|332030425|gb|EGI70113.1| Protein fem-1-like protein B [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307178909|gb|EFN67437.1| Protein fem-1-like protein B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|229577406|ref|NP_001153369.1| feminization 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|91087297|ref|XP_975561.1| PREDICTED: similar to fem-1 homolog b [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383858022|ref|XP_003704502.1| PREDICTED: protein fem-1 homolog B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|270009534|gb|EFA05982.1| hypothetical protein TcasGA2_TC008808 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307211423|gb|EFN87550.1| Protein fem-1-like protein B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350401891|ref|XP_003486298.1| PREDICTED: protein fem-1 homolog B-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query199
MGI|MGI:1335087627 Fem1b "feminization 1 homolog 0.939 0.298 0.518 2.6e-47
UNIPROTKB|F1NZR5535 F1NZR5 "Uncharacterized protei 0.939 0.349 0.507 4.2e-47
UNIPROTKB|Q5ZM55627 FEM1B "Protein fem-1 homolog B 0.939 0.298 0.507 4.2e-47
RGD|1304569627 Fem1b "fem-1 homolog b (C. ele 0.939 0.298 0.513 5.4e-47
UNIPROTKB|F1N162627 FEM1B "Uncharacterized protein 0.939 0.298 0.507 1.1e-46
UNIPROTKB|E2REP8627 FEM1B "Uncharacterized protein 0.939 0.298 0.507 1.1e-46
UNIPROTKB|Q9UK73627 FEM1B "Protein fem-1 homolog B 0.939 0.298 0.507 1.1e-46
UNIPROTKB|I3L6T4627 FEM1B "Uncharacterized protein 0.939 0.298 0.507 1.1e-46
UNIPROTKB|Q6GPE5629 fem1b "Protein fem-1 homolog B 0.939 0.297 0.518 1.4e-46
FB|FBgn0034542650 Fem-1 "Fem-1" [Drosophila mela 0.939 0.287 0.4 3.9e-30
MGI|MGI:1335087 Fem1b "feminization 1 homolog b (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 495 (179.3 bits), Expect = 2.6e-47, P = 2.6e-47
 Identities = 98/189 (51%), Positives = 128/189 (67%)

Query:     2 EDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPV 61
             E NL T LYL+ I TK     SEE++ RI K +++L  L   +R+  SLLHL VN  TPV
Sbjct:   441 ECNLYTFLYLVCISTKT--QCSEEDQCRINKQIYNLIHLDPRTREGFSLLHLAVNSNTPV 498

Query:    62 DTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILD 121
             D FHTNDVC FP A  TKLL+ CGA+VNA D +GN+ LHII  Y R ISDF TLH+II+ 
Sbjct:   499 DDFHTNDVCSFPNALVTKLLLDCGAEVNAVDNEGNSALHIIVQYNRPISDFLTLHSIIIS 558

Query:   122 LTENGAHMDTVNNKGLTPIQATTTGVADLILRTLTKINLKCLAAKVITQNNITYKGLVPH 181
             L E GAH D  N +  TP+  +TTGV++++L+T  K++LKCLAA+ +  N+I Y+  +P 
Sbjct:   559 LVEAGAHTDMTNKQNKTPLDKSTTGVSEILLKTQMKMSLKCLAARAVRANDINYQDQIPR 618

Query:   182 DLESFIELH 190
              LE F+  H
Sbjct:   619 TLEEFVGFH 627




GO:0002070 "epithelial cell maturation" evidence=IMP
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISO
GO:0005123 "death receptor binding" evidence=ISO
GO:0005515 "protein binding" evidence=IPI
GO:0005634 "nucleus" evidence=ISO;IDA
GO:0005737 "cytoplasm" evidence=ISO
GO:0006915 "apoptotic process" evidence=IEA
GO:0016567 "protein ubiquitination" evidence=IDA
GO:0042981 "regulation of apoptotic process" evidence=ISO
GO:0051438 "regulation of ubiquitin-protein ligase activity" evidence=ISO
GO:0060442 "branching involved in prostate gland morphogenesis" evidence=IMP
GO:0060743 "epithelial cell maturation involved in prostate gland development" evidence=IMP
GO:2000001 "regulation of DNA damage checkpoint" evidence=ISO
UNIPROTKB|F1NZR5 F1NZR5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZM55 FEM1B "Protein fem-1 homolog B" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1304569 Fem1b "fem-1 homolog b (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1N162 FEM1B "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2REP8 FEM1B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UK73 FEM1B "Protein fem-1 homolog B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6T4 FEM1B "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6GPE5 fem1b "Protein fem-1 homolog B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
FB|FBgn0034542 Fem-1 "Fem-1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P0C6P7FEM1B_RATNo assigned EC number0.51320.93960.2982yesN/A
Q9Z2G0FEM1B_MOUSENo assigned EC number0.51850.93960.2982yesN/A
Q5ZM55FEM1B_CHICKNo assigned EC number0.50790.93960.2982yesN/A
Q9UK73FEM1B_HUMANNo assigned EC number0.50790.93960.2982yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-07
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-06
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-04
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 6e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.002
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.002
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.003
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.004
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 46.2 bits (110), Expect = 8e-07
 Identities = 23/62 (37%), Positives = 34/62 (54%), Gaps = 8/62 (12%)

Query: 79  KLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLT 138
           KLL+  GADVNA+D  GNTPLH+ A              ++  L ++GA ++  +  G T
Sbjct: 57  KLLLEKGADVNARDKDGNTPLHLAARNGN--------LDVVKLLLKHGADVNARDKDGRT 108

Query: 139 PI 140
           P+
Sbjct: 109 PL 110


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 199
KOG4412|consensus226 99.95
KOG4412|consensus226 99.93
PHA02875 413 ankyrin repeat protein; Provisional 99.9
PHA02791284 ankyrin-like protein; Provisional 99.89
KOG0509|consensus 600 99.88
PHA02878 477 ankyrin repeat protein; Provisional 99.88
PHA02791284 ankyrin-like protein; Provisional 99.88
KOG0508|consensus615 99.88
PHA02946 446 ankyin-like protein; Provisional 99.87
PHA02859209 ankyrin repeat protein; Provisional 99.86
PHA03100 480 ankyrin repeat protein; Provisional 99.86
PHA03100 480 ankyrin repeat protein; Provisional 99.85
PHA02859209 ankyrin repeat protein; Provisional 99.85
PHA02874 434 ankyrin repeat protein; Provisional 99.85
PHA02874 434 ankyrin repeat protein; Provisional 99.84
KOG0510|consensus 929 99.84
PHA03095 471 ankyrin-like protein; Provisional 99.84
PHA02878 477 ankyrin repeat protein; Provisional 99.84
PHA02741169 hypothetical protein; Provisional 99.84
PHA02875 413 ankyrin repeat protein; Provisional 99.84
KOG0195|consensus 448 99.83
PHA03095 471 ankyrin-like protein; Provisional 99.83
KOG0509|consensus 600 99.83
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.83
PHA02876 682 ankyrin repeat protein; Provisional 99.83
PHA02795 437 ankyrin-like protein; Provisional 99.82
PLN03192823 Voltage-dependent potassium channel; Provisional 99.82
PHA02798 489 ankyrin-like protein; Provisional 99.82
PHA02989 494 ankyrin repeat protein; Provisional 99.81
PHA02743166 Viral ankyrin protein; Provisional 99.81
PHA02917 661 ankyrin-like protein; Provisional 99.81
PHA02876 682 ankyrin repeat protein; Provisional 99.8
PHA02946 446 ankyin-like protein; Provisional 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.8
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.8
KOG0502|consensus296 99.8
KOG0514|consensus452 99.79
PHA02884300 ankyrin repeat protein; Provisional 99.79
PHA02743166 Viral ankyrin protein; Provisional 99.78
PHA02989 494 ankyrin repeat protein; Provisional 99.78
KOG4177|consensus 1143 99.77
PHA02798 489 ankyrin-like protein; Provisional 99.77
KOG0510|consensus 929 99.77
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.76
KOG0508|consensus 615 99.75
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.75
PHA02917 661 ankyrin-like protein; Provisional 99.75
KOG0512|consensus228 99.75
KOG0512|consensus228 99.74
PHA02730 672 ankyrin-like protein; Provisional 99.74
PHA02736154 Viral ankyrin protein; Provisional 99.71
PHA02730 672 ankyrin-like protein; Provisional 99.7
KOG0505|consensus 527 99.69
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.68
PHA02884300 ankyrin repeat protein; Provisional 99.67
PHA02741169 hypothetical protein; Provisional 99.67
KOG3676|consensus 782 99.67
KOG4177|consensus 1143 99.67
KOG0502|consensus296 99.66
KOG4214|consensus117 99.66
PHA02792 631 ankyrin-like protein; Provisional 99.66
PHA02795437 ankyrin-like protein; Provisional 99.64
PHA02792 631 ankyrin-like protein; Provisional 99.62
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.61
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.6
KOG0195|consensus 448 99.58
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.56
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.55
KOG0507|consensus 854 99.54
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.49
KOG0507|consensus 854 99.44
KOG0514|consensus452 99.44
KOG0515|consensus752 99.44
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.44
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.43
KOG4214|consensus117 99.43
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.39
KOG3676|consensus 782 99.37
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.36
KOG0505|consensus 527 99.36
KOG1710|consensus 396 99.25
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.25
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.21
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.17
KOG4369|consensus 2131 99.16
KOG1710|consensus 396 99.1
KOG4369|consensus 2131 98.97
KOG0515|consensus752 98.93
KOG0783|consensus 1267 98.85
KOG0783|consensus 1267 98.79
PF1360630 Ank_3: Ankyrin repeat 98.76
KOG0506|consensus622 98.73
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.72
KOG0818|consensus 669 98.69
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.64
PF1360630 Ank_3: Ankyrin repeat 98.64
KOG0522|consensus 560 98.55
KOG0705|consensus749 98.53
KOG0818|consensus 669 98.52
KOG0705|consensus749 98.45
KOG0511|consensus 516 98.29
KOG0782|consensus1004 98.28
KOG0521|consensus785 98.27
KOG0521|consensus785 98.26
KOG0782|consensus1004 98.25
KOG2384|consensus223 98.14
KOG0506|consensus622 98.13
KOG0522|consensus 560 98.12
KOG0511|consensus 516 97.9
KOG0520|consensus 975 97.82
KOG2505|consensus591 97.6
KOG2384|consensus223 97.48
KOG3609|consensus 822 96.73
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.72
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.52
KOG3609|consensus 822 96.47
KOG2505|consensus591 96.45
KOG0520|consensus 975 96.04
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.4
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 88.34
>KOG4412|consensus Back     alignment and domain information
Probab=99.95  E-value=5e-28  Score=173.24  Aligned_cols=142  Identities=23%  Similarity=0.244  Sum_probs=127.7

Q ss_pred             ccchhhHHHHHHHHhhccccCChhHHHHHHHHHH-cCCCcccccCCCchHHHHHHhcCC-CC------------------
Q psy8420           2 EDNLVTSLYLLVILTKVIKNISEEEEYRIYKLVF-SLNKLSVASRQNQSLLHLCVNYET-PV------------------   61 (199)
Q Consensus         2 ~~~g~t~Lh~a~~~~~~~~~~~~~~~~~~~~ll~-~g~~i~~~~~~g~t~L~~a~~~~~-~~------------------   61 (199)
                      |..|+||||+||..|+         .++++.|++ .+..+|.+|..|.||||.|+..|+ ++                  
T Consensus        35 dqD~Rt~LHwa~S~g~---------~eiv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn~  105 (226)
T KOG4412|consen   35 DQDGRTPLHWACSFGH---------VEIVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTNG  105 (226)
T ss_pred             cccCCceeeeeeecCc---------hhHHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecCC
Confidence            3579999999999999         999999995 689999999999999999999998 54                  


Q ss_pred             CcccccccccCCcHHHHHHHHhcCCCCccCCCCCCcHHHHHHhccCcccchhhHHHHHHHHHHcCCCCCCCCCCCCCccc
Q psy8420          62 DTFHTNDVCKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQ  141 (199)
Q Consensus        62 ~~~~l~~~~~~~~~~~~~~Ll~~ga~v~~~d~~g~tpl~~a~~~~~~~~~~~~~~~~~~~Ll~~ga~~~~~~~~g~tpl~  141 (199)
                      |.+++|+|+..+..+++++|+++|+.++.+|..|.||||-|+..|..        +++++|+.+|+.+|..|..|+||||
T Consensus       106 G~T~LHyAagK~r~eIaqlLle~ga~i~~kD~~~qtplHRAAavGkl--------kvie~Li~~~a~~n~qDk~G~TpL~  177 (226)
T KOG4412|consen  106 GQTCLHYAAGKGRLEIAQLLLEKGALIRIKDKQGQTPLHRAAAVGKL--------KVIEYLISQGAPLNTQDKYGFTPLH  177 (226)
T ss_pred             CcceehhhhcCChhhHHHHHHhcCCCCcccccccCchhHHHHhccch--------hhHHHHHhcCCCCCcccccCccHHH
Confidence            78999999999999999999999999999999999999999999999        9999999999999999999999999


Q ss_pred             c----ccchHHHHHHhhcccchh
Q psy8420         142 A----TTTGVADLILRTLTKINL  160 (199)
Q Consensus       142 ~----~~~~~~~~ll~~~~~~~~  160 (199)
                      .    ...+....|++.+++...
T Consensus       178 ~al~e~~~d~a~lLV~~gAd~~~  200 (226)
T KOG4412|consen  178 HALAEGHPDVAVLLVRAGADTDR  200 (226)
T ss_pred             HHHhccCchHHHHHHHhccceee
Confidence            8    334456667777655443



>KOG4412|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 3e-05
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-05
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-04
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-04
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-04
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-04
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-04
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-04
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 4e-04
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 4e-04
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 4e-04
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 8e-04
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure

Iteration: 1

Score = 45.1 bits (105), Expect = 3e-05, Method: Compositional matrix adjust. Identities = 24/63 (38%), Positives = 37/63 (58%), Gaps = 8/63 (12%) Query: 79 KLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLT 138 ++L+ GADVNA D +GNTPLH+ A Y+ I+ L ++GA ++ +N G T Sbjct: 31 RILMANGADVNANDRKGNTPLHLAADYDHL--------EIVEVLLKHGADVNAHDNDGST 82 Query: 139 PIQ 141 P+ Sbjct: 83 PLH 85
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query199
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-11
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-09
2etb_A256 Transient receptor potential cation channel subfam 4e-10
2etb_A256 Transient receptor potential cation channel subfam 1e-04
2etb_A256 Transient receptor potential cation channel subfam 2e-04
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-08
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-06
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-06
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 4e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-09
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-07
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 7e-06
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-05
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-07
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-09
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-09
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-06
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-05
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-04
2pnn_A273 Transient receptor potential cation channel subfa 1e-08
2pnn_A273 Transient receptor potential cation channel subfa 9e-04
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-08
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-08
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-07
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-07
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-07
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-06
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-05
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-07
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-05
1awc_B153 Protein (GA binding protein beta 1); complex (tran 8e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-07
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-06
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-08
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-06
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-08
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-06
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-06
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-05
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-04
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-07
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-07
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-06
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-05
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-08
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-06
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-05
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-05
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-05
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 2e-04
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 9e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-08
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-08
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-07
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-07
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-08
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-06
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-05
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-05
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 6e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-08
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 5e-07
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-05
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 8e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 6e-08
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 8e-08
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-07
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 4e-06
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-05
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 8e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 9e-08
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 5e-06
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-08
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-07
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-08
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-07
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-06
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-07
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-07
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-06
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 6e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-07
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-05
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-05
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 6e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-07
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-06
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-05
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 2e-04
2rfa_A232 Transient receptor potential cation channel subfa 2e-07
2rfa_A232 Transient receptor potential cation channel subfa 1e-05
2rfa_A232 Transient receptor potential cation channel subfa 1e-04
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-07
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-07
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-06
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-05
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-04
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-07
3jxi_A260 Vanilloid receptor-related osmotically activated p 4e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-07
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-06
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-05
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-04
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-07
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-07
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-06
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-05
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 8e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-07
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-06
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-07
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-07
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-06
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 6e-04
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-06
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 4e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-07
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-06
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 6e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-07
3hra_A201 Ankyrin repeat family protein; structural protein; 9e-06
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-05
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-06
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-06
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-04
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 9e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-06
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 4e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-06
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-04
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 6e-06
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-05
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-06
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-06
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 8e-05
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-04
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 9e-06
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-05
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-05
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 7e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
 Score = 58.9 bits (143), Expect = 3e-11
 Identities = 14/91 (15%), Positives = 33/91 (36%), Gaps = 5/91 (5%)

Query: 75  AATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNN 134
               K+ +  GAD+ A        +     +   + + + +    L  +++G  +   + 
Sbjct: 94  TELCKIFLEKGADITALYKPYKIVVF-KNIFNYFVDENEMIPLYKLIFSQSGLQLLIKDK 152

Query: 135 KGLTPIQ-ATTTG---VADLILRTLTKINLK 161
            GLT ++            ++   + K NLK
Sbjct: 153 WGLTALEFVKRCQKPIALKMMEDYIKKYNLK 183


>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.95
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.93
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.93
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.93
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.93
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.93
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.93
3hra_A201 Ankyrin repeat family protein; structural protein; 99.93
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.92
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.92
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.92
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.92
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.92
2rfa_A232 Transient receptor potential cation channel subfa 99.92
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.92
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.92
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.91
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.91
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.91
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.91
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.91
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.91
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.91
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.91
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.91
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.91
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.91
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.91
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.91
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.91
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.91
2etb_A256 Transient receptor potential cation channel subfam 99.9
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.9
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.9
2rfa_A232 Transient receptor potential cation channel subfa 99.9
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.9
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.9
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.9
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.9
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.9
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.9
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.9
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.9
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.9
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.89
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.89
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.89
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.89
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.89
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.89
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.89
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.89
2etb_A256 Transient receptor potential cation channel subfam 99.89
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.89
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.89
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.89
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.89
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.89
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.89
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.89
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.89
2pnn_A273 Transient receptor potential cation channel subfa 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.88
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.88
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.88
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.88
3hra_A201 Ankyrin repeat family protein; structural protein; 99.87
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.87
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.87
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
2pnn_A273 Transient receptor potential cation channel subfa 99.87
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.86
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.86
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.86
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.85
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.85
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.84
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.84
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.83
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.83
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.82
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.82
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.82
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.81
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.81
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.81
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.81
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.81
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.8
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.8
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.8
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.79
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.79
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.75
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.74
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.73
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.73
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.72
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.71
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.71
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.71
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.7
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.66
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.64
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=99.95  E-value=4.8e-28  Score=177.35  Aligned_cols=120  Identities=26%  Similarity=0.348  Sum_probs=86.5

Q ss_pred             hHHHHHHHHhhccccCChhHHHHHHHHHHcCCCcccccCCCchHHHHHHhcCCCCCcccccccccCCcHHHHHHHHhcCC
Q psy8420           7 TSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCGA   86 (199)
Q Consensus         7 t~Lh~a~~~~~~~~~~~~~~~~~~~~ll~~g~~i~~~~~~g~t~L~~a~~~~~~~~~~~l~~~~~~~~~~~~~~Ll~~ga   86 (199)
                      ++|+.||..|+         .++|+.|++.|+++|.+|..|.||||+|+..               ++.+++++|++.|+
T Consensus         6 ~~L~~Aa~~G~---------~~~v~~Ll~~Gadvn~~d~~g~t~l~~a~~~---------------~~~~~~~~ll~~ga   61 (169)
T 4gpm_A            6 KRLIEAAENGN---------KDRVKDLIENGADVNASDSDGRTPLHHAAEN---------------GHKEVVKLLISKGA   61 (169)
T ss_dssp             HHHHHHHHTTC---------HHHHHHHHHTTCCTTCCCTTSCCHHHHHHHT---------------TCHHHHHHHHHTTC
T ss_pred             HHHHHHHHcCC---------HHHHHHHHHCCCCCCCcCCCCCCHHHHHHHc---------------CCHHHHHHHHhccc
Confidence            57999999999         9999999999999999999999999999999               55566666666666


Q ss_pred             CCccCCCCCCcHHHHHHhccCcccchhhHHHHHHHHHHcCCCCCCCCCCCCCcccc----ccchHHHHHHhhcccc
Q psy8420          87 DVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQA----TTTGVADLILRTLTKI  158 (199)
Q Consensus        87 ~v~~~d~~g~tpl~~a~~~~~~~~~~~~~~~~~~~Ll~~ga~~~~~~~~g~tpl~~----~~~~~~~~ll~~~~~~  158 (199)
                      +++.+|..|+||||+|+..++.        +++++|+++|++++.+|..|.||||+    ...++++.|++.+++.
T Consensus        62 d~~~~d~~g~TpLh~A~~~g~~--------~~v~~Ll~~gadvn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~  129 (169)
T 4gpm_A           62 DVNAKDSDGRTPLHHAAENGHK--------EVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLISKGADV  129 (169)
T ss_dssp             CTTCCCTTSCCHHHHHHHTTCH--------HHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCT
T ss_pred             chhhhccCCCCHHHHHHHcCCH--------HHHHHHHHCcCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCc
Confidence            6666666666666666666655        66666666666666666666666655    3445555555554443



>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 199
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-07
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 9e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-04
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 0.002
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-07
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-04
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-05
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 0.001
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-06
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-05
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 0.002
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-06
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-04
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-05
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.002
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.003
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 0.001
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.001
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 48.4 bits (114), Expect = 1e-07
 Identities = 15/71 (21%), Positives = 25/71 (35%), Gaps = 8/71 (11%)

Query: 70  CKFPCAATTKLLIRCGADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHM 129
                    K L++ GA  N  + +  TPLH+ A              +   L +N A +
Sbjct: 8   SFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHT--------EVAKYLLQNKAKV 59

Query: 130 DTVNNKGLTPI 140
           +       TP+
Sbjct: 60  NAKAKDDQTPL 70


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query199
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.94
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.92
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.91
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.89
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.89
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.89
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.89
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.88
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.88
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.87
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.87
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.86
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.86
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.82
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.81
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.8
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.79
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.79
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.77
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.75
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.73
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.7
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.7
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.7
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.69
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.67
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.59
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.58
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.58
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.47
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.46
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.94  E-value=4.2e-27  Score=160.83  Aligned_cols=115  Identities=19%  Similarity=0.172  Sum_probs=108.4

Q ss_pred             hhHHHHHHHHhhccccCChhHHHHHHHHHHcCCCcccccCCCchHHHHHHhcCCCCCcccccccccCCcHHHHHHHHhcC
Q psy8420           6 VTSLYLLVILTKVIKNISEEEEYRIYKLVFSLNKLSVASRQNQSLLHLCVNYETPVDTFHTNDVCKFPCAATTKLLIRCG   85 (199)
Q Consensus         6 ~t~Lh~a~~~~~~~~~~~~~~~~~~~~ll~~g~~i~~~~~~g~t~L~~a~~~~~~~~~~~l~~~~~~~~~~~~~~Ll~~g   85 (199)
                      .|||++|++.|+         .++++.|++.|++++.++..|.||||+|+..               ++.++++++++.|
T Consensus         3 ~tpL~~A~~~g~---------~~~v~~Ll~~g~d~n~~~~~g~t~lh~A~~~---------------~~~~~~~~ll~~g   58 (118)
T d1myoa_           3 DKEFMWALKNGD---------LDEVKDYVAKGEDVNRTLEGGRKPLHYAADC---------------GQLEILEFLLLKG   58 (118)
T ss_dssp             HHHHHHHHHTTC---------HHHHHHHHTTTCCCCCCSSSSCCTTHHHHHH---------------STTTHHHHHHHSS
T ss_pred             ChHHHHHHHCCC---------HHHHHHHHHhhhccccccccccccccccccc---------------ccccccccccccc
Confidence            589999999999         9999999999999999999999999999999               8999999999999


Q ss_pred             CCCccCCCCCCcHHHHHHhccCcccchhhHHHHHHHHHHcCCCCCCCCCCCCCccccccchHHHHHH
Q psy8420          86 ADVNAKDYQGNTPLHIIATYERAISDFQTLHTIILDLTENGAHMDTVNNKGLTPIQATTTGVADLIL  152 (199)
Q Consensus        86 a~v~~~d~~g~tpl~~a~~~~~~~~~~~~~~~~~~~Ll~~ga~~~~~~~~g~tpl~~~~~~~~~~ll  152 (199)
                      ++++.+|..|+||||+|+..++.        +++++|+++|++++.+|..|.||||++..+.++.||
T Consensus        59 ~din~~d~~g~tpLh~A~~~~~~--------~~v~~Ll~~Gad~~~~d~~G~t~l~~a~~~~i~~LL  117 (118)
T d1myoa_          59 ADINAPDKHHITPLLSAVYEGHV--------SCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALL  117 (118)
T ss_dssp             CTTTCCSSSCSCHHHHHHTTTCC--------HHHHHHHTTCCCSSSSSSSTCCCCCTCSSTTTGGGG
T ss_pred             ceeeecccccccchhhhhhcCch--------hhhhhhhcccccceeeCCCCCCHHHHHhHHHHHHhc
Confidence            99999999999999999999999        999999999999999999999999997665555444



>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure