Diaphorina citri psyllid: psy8434

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----

YSQVVLDVNRSLKRFPPGIPIEQRLALQDQLTLLILKVIHAYPRLRYYQGYHDVAITFLLVVGEMKAFRILEVLSNDHLSENMRDTMDETSYVLNYMFPLVNKRSSDLCEFLER

ccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHc

YSQVVLDVNRSLKRFPPGIPIEQRLALQDQLTLLILKVIHAYPRLRYYQGYHDVAITFLLVVGEMKAFRILEVLSNDHLSENMRDTMDETSYVLNYMFPLVNKRSSDLCEFLER

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

YSQVVLDVNRSLKRFPPGIPIEQRLALQDQLTLLILKVIHAYPRLRYYQGYHDVAITFLLVVGEMKAFRILEVLSNDHLSENMRDTMDETSYVLNYMFPLVNKRSSDLCEFLER

Annotation	Function Description	Confidence Level	Reference Protein
TBC1 domain family member 20	May act as a GTPase-activating protein for Rab family protein(s).	confident	Q96BZ9
TBC1 domain family member 20	May act as a GTPase-activating protein for Rab family protein(s).	confident	Q9D9I4

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

No EC number assigned to the protein, probably not an enzyme!

Template: 4HL4, chain A
Confidence level:very confident
Coverage over the Query: 2-114
View the alignment between query and template
View the model in PyMOL