Diaphorina citri psyllid: psy8443


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330
MIKLRIRWFKFDECALEDHGCEHTCKNILGGYECSCKIGYELHSDGKICVGSVKARDACGGILKHSNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSSCEYDNLTVFSKIGDSFKSQGVFCGSKLPPVILSEGNALRIEFHSDNSVQKSGFSAFFFTDKDECMTNNGGCQHECRNTIGSYICSCHNGYTLLENGHDCKEGGCKYEITAPNGVIKTPNHPDYYPSKRECIWHFTTTPGHRIKLVFQEFELEPHQTCAYDHVVMYDGDSPDSLTLGRFCGIKLPYPIITGSNQLYMMFKSDASVQRKGFIATHTT
cccEEEEEEEEccccccccccccEEEEccccEEEEEcccEEEECcccCECccccCCcccccEEEcccCEEEcccccccccccccEEEEEEcccccEEEEEEEEEEEcccccccccccccEEEEEEcccccccCEEEECcccccccEEEcccEEEEEEEEccccccccEEEEEEECccccccccccccccccccccEEEEEEcccEEEccccccccccccccEECcccCEEEcccccccccccccEEEEEEcccccEEEEEEEEEEEcccccccccEEEEECccccccccCCccccccccccEEECccEEEEEEEEccccccccEEEEEEc
MIKLRIRWFKFDECALEDHGCEHTCKNILGGYECSCKIGYELHSDGKICVGSVKARDACGGILKHSNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSSCEYDNLTVFSKIGDSFKSQGVFCGSKLPPVILSEGNALRIEFHSDNSVQKSGFSAFFFTDKDECMTNNGGCQHECRNTIGSYICSCHNGYTLLENGHDCKEGGCKYEITAPNGVIKTPNHPDYYPSKRECIWHFTTTPGHRIKLVFQEFELEPHQTCAYDHVVMYDGDSPDSLTLGRFCGIKLPYPIITGSNQLYMMFKSDASVQRKGFIATHTT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKLRIRWFKFDECALEDHGCEHTCKNILGGYECSCKIGYELHSDGKICVGSVKARDACGGILKHSNGTLTSPSFPDLYIKNKTCIWEIVAPPQYRISLNFTHFDIEGNNLFQSSCEYDNLTVFSKIGDSFKSQGVFCGSKLPPVILSEGNALRIEFHSDNSVQKSGFSAFFFTDKDECMTNNGGCQHECRNTIGSYICSCHNGYTLLENGHDCKEGGCKYEITAPNGVIKTPNHPDYYPSKRECIWHFTTTPGHRIKLVFQEFELEPHQTCAYDHVVMYDGDSPDSLTLGRFCGIKLPYPIITGSNQLYMMFKSDASVQRKGFIATHTT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dorsal-ventral patterning tolloid-like protein 1 Required for patterning ventral tissues of the tail. May increase bone morphogenetic protein (BMP) activity at the end of gastrulation by proteolytic cleavage of chordin and release of BMP from inactive complexes.confidentO57460
Tolloid-like protein 2 Protease which specifically processes pro-lysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.confidentQ9Y6L7
Tolloid-like protein 2 Protease which specifically processes pro-lysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.confidentQ9WVM6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004252 [MF]serine-type endopeptidase activityprobableGO:0016787, GO:0004175, GO:0017171, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008236
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0005518 [MF]collagen bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0061036 [BP]positive regulation of cartilage developmentprobableGO:0051094, GO:0050793, GO:0008150, GO:0061035, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0050789
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0035107 [BP]appendage morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048736, GO:0009653, GO:0007275, GO:0044699
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0016485 [BP]protein processingprobableGO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0031988 [CC]membrane-bounded vesicleprobableGO:0005575, GO:0031982, GO:0043226
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UZK, chain A
Confidence level:very confident
Coverage over the Query: 167-215
View the alignment between query and template
View the model in PyMOL
Template: 3KQ4, chain B
Confidence level:very confident
Coverage over the Query: 57-175,216-330
View the alignment between query and template
View the model in PyMOL
Template: 4AQB, chain A
Confidence level:very confident
Coverage over the Query: 3-211
View the alignment between query and template
View the model in PyMOL