Diaphorina citri psyllid: psy8444


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
NGHDCKEGGCKYEITAPNGVIKTPNHPDYYPSKRECIWHFTTTPGHRIKLVFQEFELEPHQTCAYDHVVMYDGDSPDSLTLGRFCGIKLPYPIITGSNQLYMMFKSDASVQRKGFIATHTTVCGGHLQAQDYKRHLYSHARYGHDNYGKSMDCDWTIEAEPGKNVHLTFLTFDIESNKDCEYDYVEVYSGLDSSVSQASYGRFCGTTVALKFQSFRDLRIMTSVHMIMLRLEMGMPPDSPIIGNLLRI
ccccccccccccEEEcccCEEEccccccccccccccEEEEEEccccEEEEEEEEEEEcccccccccEEEEEcccccccccCECcccccccccEEEcccEEEEEEEEccccccccEEEEEEEEcccEEEcccccccEEEcccccccccccccccEEEEEEccccEEEEEEEEEEECccccccccEEEEEEccccccccccEEccccccccccEEEcccEEEEEEEEccEEEEECcccccccccccEEEc
***DCKEGGCKYEITAPNGVIKTPNHPDYYPSKRECIWHFTTTPGHRIKLVFQEFELEPHQTCAYDHVVMYDGDSPDSLTLGRFCGIKLPYPIITGSNQLYMMFKSDASVQRKGFIATHTTVCGGHLQAQDYKRHLYSHARYGHDNYGKSMDCDWTIEAEPGKNVHLTFLTFDIESNKDCEYDYVEVYSGLDSSVSQASYGRFCGTTVALKFQSFRDLRIMTSVHMIMLRLEMGMPPDSPIIGNLLRI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NGHDCKEGGCKYEITAPNGVIKTPNHPDYYPSKRECIWHFTTTPGHRIKLVFQEFELEPHQTCAYDHVVMYDGDSPDSLTLGRFCGIKLPYPIITGSNQLYMMFKSDASVQRKGFIATHTTVCGGHLQAQDYKRHLYSHARYGHDNYGKSMDCDWTIEAEPGKNVHLTFLTFDIESNKDCEYDYVEVYSGLDSSVSQASYGRFCGTTVALKFQSFRDLRIMTSVHMIMLRLEMGMPPDSPIIGNLLRI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dorsal-ventral patterning tolloid-like protein 1 Required for patterning ventral tissues of the tail. May increase bone morphogenetic protein (BMP) activity at the end of gastrulation by proteolytic cleavage of chordin and release of BMP from inactive complexes.confidentO57460
Tolloid-like protein 1 Protease which processes procollagen C-propeptides, such as chordin, pro-biglycan and pro-lysyl oxidase. Required for the embryonic development. Predominant protease, which in the development, influences dorsal-ventral patterning and skeletogenesis.confidentO43897

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0008233 [MF]peptidase activityprobableGO:0016787, GO:0003674, GO:0003824
GO:0030659 [CC]cytoplasmic vesicle membraneprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0016485 [BP]protein processingprobableGO:0044238, GO:0051604, GO:0019538, GO:0043170, GO:0071704, GO:0010467, GO:0008150, GO:0008152
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0030139 [CC]endocytic vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KQ4, chain B
Confidence level:very confident
Coverage over the Query: 8-228
View the alignment between query and template
View the model in PyMOL