Diaphorina citri psyllid: psy8455


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-
MSRIAKTAFPSRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQNQLPIISAESALILRNPVAKCATGAHTGQSL
ccHHHHHHccccccccEEEEccccccccEEEEEECccCEEEEEEEccccEEEEcccccccHHHHHHHHHHccccEEEccccEEEEcccccccccccccccc
*SRIAKTAFPSRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQNQLPIISAESALILRNPVAK***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRIAKTAFPSRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQNQLPIISAESALILRNPVAKCATGAHTGQSL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SHC-transforming protein 1 Signaling adapter that couples activated growth factor receptors to signaling pathways. Participates in a signaling cascade initiated by activated KIT and KITLG/SCF. Isoform p46Shc and isoform p52Shc, once phosphorylated, couple activated receptor tyrosine kinases to Ras via the recruitment of the GRB2/SOS complex and are implicated in the cytoplasmic propagation of mitogenic signals. Isoform p46Shc and isoform p52Shc may thus function as initiators of the Ras signaling cascade in various non-neuronal systems. Isoform p66Shc does not mediate Ras activation, but is involved in signal transduction pathways that regulate the cellular response to oxidative stress and life span. Isoform p66Shc acts as a downstream target of the tumor suppressor p53 and is indispensable for the ability of stress-activated p53 to induce elevation of intracellular oxidants, cytochrome c release and apoptosis. The expression of isoform p66Shc has been correlated with life span (By similarity). Participates in signaling downstream of the angiopoietin receptor TEK/TIE2, and plays a role in the regulation of endothelial cell migration and sprouting angiogenesis.confidentP29353
SHC-transforming protein 1 Signaling adapter that couples activated growth factor receptors to signaling pathways. Participates in signaling downstream of the angiopoietin receptor TEK/TIE2, and plays a role in the regulation of endothelial cell migration and sprouting angiogenesis (By similarity). Participates in a signaling cascade initiated by activated KIT and KITLG/SCF. Isoform p47Shc and isoform p52Shc, once phosphorylated, couple activated receptor kinases to Ras via the recruitment of the GRB2/SOS complex and are implicated in the cytoplasmic propagation of mitogenic signals. Isoform p47Shc and isoform p52 may thus function as initiators of the Ras signaling cascade in various non-neuronal systems. Isoform p66Shc does not mediate Ras activation, but is involved in signal transduction pathways that regulate the cellular response to oxidative stress and life span. Isoform p66Shc acts as a downstream target of the tumor suppressor p53 and is indispensable for the ability of stress-activated p53 to induce elevation of intracellular oxidants, cytochrome c release and apoptosis. The expression of isoform p66Shc has been correlated with life span.confidentP98083
SHC-transforming protein 1 Signaling adapter that couples activated growth factor receptors to signaling pathways. Participates in a signaling cascade initiated by activated KIT and KITLG/SCF. Participates in signaling downstream of the angiopoietin receptor TEK/TIE2, and plays a role in the regulation of endothelial cell migration and sprouting angiogenesis.confidentQ5R7W7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000165 [BP]MAPK cascadeprobableGO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0010008 [CC]endosome membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0070435 [CC]Shc-EGFR complexprobableGO:0043234, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005159 [MF]insulin-like growth factor receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005158 [MF]insulin receptor bindingprobableGO:0032403, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005168 [MF]neurotrophin TRKA receptor bindingprobableGO:0005126, GO:0005167, GO:0005165, GO:0003674, GO:0005488, GO:0005515, GO:0005102
GO:0000187 [BP]activation of MAPK activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0004713 [MF]protein tyrosine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0031100 [BP]organ regenerationprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0031099, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0035094 [BP]response to nicotineprobableGO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:1901698, GO:0014070
GO:0045740 [BP]positive regulation of DNA replicationprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0031328, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0051054, GO:0045935, GO:0051052, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0006275, GO:0010557, GO:0010556, GO:0048522
GO:0008286 [BP]insulin receptor signaling pathwayprobableGO:0042221, GO:0007169, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0032869, GO:0032868, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:1901698, GO:0071417, GO:0071310, GO:0065007, GO:0071495, GO:0044700, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0010243, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0050896
GO:0050900 [BP]leukocyte migrationprobableGO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0002376, GO:0051674, GO:0008150, GO:0044763, GO:0016477, GO:0051179, GO:0044699
GO:0009636 [BP]response to toxic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0006468 [BP]protein phosphorylationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0019897 [CC]extrinsic to plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035011 [BP]melanotic encapsulation of foreign targetprobableGO:0035006, GO:1901360, GO:0044710, GO:0042440, GO:0071704, GO:0006582, GO:0045087, GO:0019748, GO:0006725, GO:0006952, GO:0035010, GO:0006950, GO:0008150, GO:0008152, GO:0006955, GO:0018958, GO:0050896, GO:0044237, GO:0002376, GO:0002252, GO:0009987, GO:1901615
GO:0042542 [BP]response to hydrogen peroxideprobableGO:1901700, GO:0050896, GO:0000302, GO:0006950, GO:0008150, GO:0042221, GO:0010035, GO:0006979
GO:0001784 [MF]phosphotyrosine bindingprobableGO:0003674, GO:0051219, GO:0005488, GO:0005515, GO:0045309
GO:0051384 [BP]response to glucocorticoid stimulusprobableGO:0009719, GO:0033993, GO:0031960, GO:0050896, GO:0008150, GO:0048545, GO:0009725, GO:0042221, GO:0010033, GO:0014070
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0001525 [BP]angiogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0001568, GO:0048856, GO:0001944, GO:0044767, GO:0072359, GO:0072358, GO:0048514, GO:0048646, GO:0048731, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0031532 [BP]actin cytoskeleton reorganizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0008293 [BP]torso signaling pathwayprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0051716, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0010468, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0007154, GO:0044700, GO:0050896, GO:0051252, GO:0006355, GO:0010556, GO:0008150
GO:0046875 [MF]ephrin receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005154 [MF]epidermal growth factor receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515, GO:0070851
GO:0007176 [BP]regulation of epidermal growth factor-activated receptor activityprobableGO:0019220, GO:0080090, GO:0019222, GO:0048583, GO:0061097, GO:0042058, GO:0023051, GO:1901184, GO:0010646, GO:0050789, GO:0009966, GO:0043549, GO:0051246, GO:0065007, GO:0031399, GO:0065009, GO:0010469, GO:0045859, GO:0060255, GO:0031323, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0032268, GO:0051338, GO:0001932
GO:0007173 [BP]epidermal growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0038127
GO:0048011 [BP]neurotrophin TRK receptor signaling pathwayprobableGO:0007166, GO:0007167, GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0007169, GO:0050789, GO:0044699, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0038179, GO:0009987, GO:0050794, GO:0008150, GO:0042221, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0044763
GO:0007426 [BP]tracheal outgrowth, open tracheal systemprobableGO:0060541, GO:0007424, GO:0032501, GO:0035239, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0048731, GO:0035295, GO:0009653, GO:0032502, GO:0007275, GO:0044699
GO:0005543 [MF]phospholipid bindingprobableGO:0043168, GO:0043167, GO:0003674, GO:0008289, GO:0005488
GO:0008543 [BP]fibroblast growth factor receptor signaling pathwayprobableGO:0007166, GO:0007167, GO:0070848, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0007169, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0044344, GO:0071310, GO:0065007, GO:0071495, GO:0009987, GO:0050794, GO:0044763, GO:0007154, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0071774, GO:0008150
GO:0045907 [BP]positive regulation of vasoconstrictionprobableGO:0044057, GO:0051240, GO:0019229, GO:0065007, GO:0051239, GO:0048518, GO:0008150, GO:0050789
GO:0006987 [BP]activation of signaling protein activity involved in unfolded protein responseprobableGO:0032069, GO:0048522, GO:0019220, GO:0080090, GO:0019222, GO:0033674, GO:0051246, GO:0031325, GO:0031323, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0050789, GO:0043085, GO:0009893, GO:0006984, GO:0051716, GO:0006986, GO:0051347, GO:0010604, GO:0051345, GO:0010562, GO:0043549, GO:0034976, GO:0051247, GO:0019219, GO:0071310, GO:0032270, GO:0044699, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0042325, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0032075, GO:0051174, GO:0006950, GO:0032268, GO:0044763, GO:0051171, GO:0007154, GO:0050794, GO:0010033, GO:0051336, GO:0044700, GO:0042327, GO:0045860, GO:0030968, GO:0050896, GO:0031401, GO:0051338, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0009987, GO:0001932, GO:0001934, GO:0034620
GO:0030168 [BP]platelet activationprobableGO:0009987, GO:0007599, GO:0050878, GO:0044707, GO:0006950, GO:0032501, GO:0007596, GO:0009611, GO:0042060, GO:0065007, GO:0001775, GO:0050817, GO:0044763, GO:0008150, GO:0065008, GO:0050896, GO:0044699
GO:0005068 [MF]transmembrane receptor protein tyrosine kinase adaptor activityprobableGO:0030674, GO:0030971, GO:0035591, GO:0003674, GO:0005488, GO:0005515, GO:0005102, GO:0060090
GO:0007507 [BP]heart developmentprobableGO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0001666 [BP]response to hypoxiaprobableGO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0007265 [BP]Ras protein signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007264, GO:0050789, GO:0044699
GO:0007568 [BP]agingprobableGO:0044767, GO:0032502, GO:0008150, GO:0044699
GO:0040008 [BP]regulation of growthprobableGO:0008150, GO:0065007, GO:0050789
GO:0048661 [BP]positive regulation of smooth muscle cell proliferationprobableGO:0008284, GO:0042127, GO:0048660, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MIL, chain A
Confidence level:very confident
Coverage over the Query: 1-92
View the alignment between query and template
View the model in PyMOL