Psyllid ID: psy8455
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| 242015724 | 419 | shc transforming protein, putative [Pedi | 0.801 | 0.193 | 0.814 | 3e-33 | |
| 328722362 | 395 | PREDICTED: SHC-transforming protein 1-li | 0.782 | 0.2 | 0.835 | 6e-32 | |
| 350399507 | 443 | PREDICTED: SHC-transforming protein 1-li | 0.811 | 0.185 | 0.756 | 4e-30 | |
| 340721047 | 443 | PREDICTED: SHC-transforming protein 1-li | 0.811 | 0.185 | 0.756 | 4e-30 | |
| 345492155 | 473 | PREDICTED: SHC-transforming protein 1-li | 0.801 | 0.171 | 0.765 | 5e-30 | |
| 307189948 | 442 | SHC-transforming protein 1 [Camponotus f | 0.772 | 0.176 | 0.782 | 5e-30 | |
| 322798995 | 410 | hypothetical protein SINV_05936 [Solenop | 0.772 | 0.190 | 0.769 | 2e-29 | |
| 383847315 | 444 | PREDICTED: SHC-transforming protein 1-li | 0.811 | 0.184 | 0.743 | 2e-29 | |
| 66520066 | 443 | PREDICTED: SHC-transforming protein 1-li | 0.772 | 0.176 | 0.769 | 3e-29 | |
| 170040326 | 430 | shc transforming protein [Culex quinquef | 0.782 | 0.183 | 0.734 | 3e-29 |
| >gi|242015724|ref|XP_002428497.1| shc transforming protein, putative [Pediculus humanus corporis] gi|212513131|gb|EEB15759.1| shc transforming protein, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 145 bits (366), Expect = 3e-33, Method: Compositional matrix adjust.
Identities = 66/81 (81%), Positives = 76/81 (93%)
Query: 12 RQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQN 71
++DG+FLVRESQGSPGQYVLTG QGG KKHLLLIDPEGVVRTKD+MFESV+HL+NYH +N
Sbjct: 338 KKDGEFLVRESQGSPGQYVLTGMQGGLKKHLLLIDPEGVVRTKDKMFESVNHLINYHVEN 397
Query: 72 QLPIISAESALILRNPVAKCA 92
QLPIISAESAL+LR+PV K +
Sbjct: 398 QLPIISAESALVLRHPVRKAS 418
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328722362|ref|XP_003247559.1| PREDICTED: SHC-transforming protein 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|350399507|ref|XP_003485550.1| PREDICTED: SHC-transforming protein 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340721047|ref|XP_003398938.1| PREDICTED: SHC-transforming protein 1-like isoform 1 [Bombus terrestris] gi|340721049|ref|XP_003398939.1| PREDICTED: SHC-transforming protein 1-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|345492155|ref|XP_001602298.2| PREDICTED: SHC-transforming protein 1-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307189948|gb|EFN74184.1| SHC-transforming protein 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322798995|gb|EFZ20455.1| hypothetical protein SINV_05936 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383847315|ref|XP_003699300.1| PREDICTED: SHC-transforming protein 1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|66520066|ref|XP_395635.2| PREDICTED: SHC-transforming protein 1-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|170040326|ref|XP_001847954.1| shc transforming protein [Culex quinquefasciatus] gi|167863881|gb|EDS27264.1| shc transforming protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 101 | ||||||
| FB|FBgn0015296 | 409 | Shc "SHC-adaptor protein" [Dro | 0.782 | 0.193 | 0.734 | 1.7e-27 | |
| UNIPROTKB|E1BSC1 | 427 | SHC4 "Uncharacterized protein" | 0.821 | 0.194 | 0.650 | 1.3e-24 | |
| ZFIN|ZDB-GENE-030131-2538 | 554 | si:dkey-246i14.4 "si:dkey-246i | 0.792 | 0.144 | 0.7 | 1.4e-24 | |
| UNIPROTKB|Q0IIE2 | 473 | SHC1 "SHC-transforming protein | 0.762 | 0.162 | 0.701 | 7.4e-24 | |
| UNIPROTKB|F1RGP5 | 474 | SHC1 "Uncharacterized protein" | 0.762 | 0.162 | 0.701 | 7.5e-24 | |
| RGD|620446 | 469 | Shc1 "SHC (Src homology 2 doma | 0.742 | 0.159 | 0.72 | 9.1e-24 | |
| UNIPROTKB|F1LN14 | 469 | Shc1 "SHC-transforming protein | 0.742 | 0.159 | 0.72 | 9.1e-24 | |
| UNIPROTKB|F5H5M1 | 344 | SHC4 "SHC-transforming protein | 0.772 | 0.226 | 0.653 | 1.4e-23 | |
| UNIPROTKB|F1PQC4 | 576 | SHC1 "Uncharacterized protein" | 0.762 | 0.133 | 0.701 | 1.5e-23 | |
| UNIPROTKB|E1B716 | 583 | SHC1 "SHC-transforming protein | 0.762 | 0.132 | 0.701 | 1.6e-23 |
| FB|FBgn0015296 Shc "SHC-adaptor protein" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 308 (113.5 bits), Expect = 1.7e-27, P = 1.7e-27
Identities = 58/79 (73%), Positives = 68/79 (86%)
Query: 12 RQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQN 71
+QDGDFLVRESQG GQYVLTG +G T KHLLLIDPEGVVRTKDR+F+S+SHL+NYH +
Sbjct: 316 QQDGDFLVRESQGKRGQYVLTGLEGKTPKHLLLIDPEGVVRTKDRIFDSISHLINYHWAH 375
Query: 72 QLPIISAESALILRNPVAK 90
LPIIS +S L+LRNPV +
Sbjct: 376 ALPIISEDSELVLRNPVRR 394
|
|
| UNIPROTKB|E1BSC1 SHC4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-2538 si:dkey-246i14.4 "si:dkey-246i14.4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0IIE2 SHC1 "SHC-transforming protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RGP5 SHC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|620446 Shc1 "SHC (Src homology 2 domain containing) transforming protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LN14 Shc1 "SHC-transforming protein 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5H5M1 SHC4 "SHC-transforming protein 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PQC4 SHC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B716 SHC1 "SHC-transforming protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| cd09925 | 104 | cd09925, SH2_SHC, Src homology 2 (SH2) domain foun | 7e-45 | |
| smart00252 | 84 | smart00252, SH2, Src homology 2 domains | 2e-12 | |
| pfam00017 | 77 | pfam00017, SH2, SH2 domain | 1e-11 | |
| cd10361 | 90 | cd10361, SH2_Fps_family, Src homology 2 (SH2) doma | 2e-10 | |
| cd10337 | 136 | cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in | 1e-09 | |
| cd00173 | 79 | cd00173, SH2, Src homology 2 (SH2) domain | 4e-09 | |
| cd10369 | 96 | cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain | 2e-07 | |
| cd09935 | 94 | cd09935, SH2_ABL, Src homology 2 (SH2) domain foun | 3e-07 | |
| cd09931 | 99 | cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo | 6e-07 | |
| cd09940 | 102 | cd09940, SH2_Vav_family, Src homology 2 (SH2) doma | 5e-06 | |
| cd10346 | 97 | cd10346, SH2_SH2B_family, Src homology 2 (SH2) dom | 6e-06 | |
| cd09943 | 93 | cd09943, SH2_Nck_family, Src homology 2 (SH2) doma | 9e-06 | |
| cd09942 | 110 | cd09942, SH2_nSH2_p85_like, N-terminal Src homolog | 9e-06 | |
| cd10352 | 91 | cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 | 2e-05 | |
| cd09941 | 95 | cd09941, SH2_Grb2_like, Src homology 2 domain foun | 4e-05 | |
| cd09945 | 98 | cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 | 6e-05 | |
| cd09944 | 108 | cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom | 7e-05 | |
| cd10409 | 98 | cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou | 8e-05 | |
| cd10405 | 103 | cd10405, SH2_Vav1, Src homology 2 (SH2) domain fou | 8e-05 | |
| cd10348 | 86 | cd10348, SH2_Cterm_shark_like, C-terminal Src homo | 1e-04 | |
| cd09929 | 121 | cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) dom | 1e-04 | |
| cd10408 | 97 | cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou | 2e-04 | |
| cd10410 | 97 | cd10410, SH2_SH2B1, Src homology 2 (SH2) domain fo | 3e-04 | |
| cd10411 | 97 | cd10411, SH2_SH2B2, Src homology 2 (SH2) domain fo | 3e-04 | |
| cd09932 | 104 | cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src | 3e-04 | |
| cd10353 | 103 | cd10353, SH2_Nterm_RasGAP, N-terminal Src homology | 4e-04 | |
| cd10354 | 77 | cd10354, SH2_Cterm_RasGAP, C-terminal Src homology | 4e-04 | |
| cd09937 | 98 | cd09937, SH2_csk_like, Src homology 2 (SH2) domain | 5e-04 | |
| cd10347 | 81 | cd10347, SH2_Nterm_shark_like, N-terminal Src homo | 9e-04 | |
| cd10412 | 97 | cd10412, SH2_SH2B3, Src homology 2 (SH2) domain fo | 0.001 | |
| cd10340 | 99 | cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo | 0.001 | |
| cd09933 | 101 | cd09933, SH2_Src_family, Src homology 2 (SH2) doma | 0.004 |
| >gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor protein C (SHC) | Back alignment and domain information |
|---|
Score = 140 bits (354), Expect = 7e-45
Identities = 56/77 (72%), Positives = 62/77 (80%)
Query: 12 RQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQN 71
+ DGDFLVRES +PGQYVLTG Q G KHLLL+DPEGVVRTKDR+FES+SHL+NYH N
Sbjct: 24 QTDGDFLVRESTTTPGQYVLTGMQNGQPKHLLLVDPEGVVRTKDRVFESISHLINYHVTN 83
Query: 72 QLPIISAESALILRNPV 88
LPIIS S L LR PV
Sbjct: 84 GLPIISEGSELHLRRPV 100
|
SHC is involved in a wide variety of pathways including regulating proliferation, angiogenesis, invasion and metastasis, and bone metabolism. An adapter protein, SHC has been implicated in Ras activation following the stimulation of a number of different receptors, including growth factors [insulin, epidermal growth factor (EGF), nerve growth factor, and platelet derived growth factor (PDGF)], cytokines [interleukins 2, 3, and 5], erythropoietin, and granulocyte/macrophage colony-stimulating factor, and antigens [T-cell and B-cell receptors]. SHC has been shown to bind to tyrosine-phosphorylated receptors, and receptor stimulation leads to tyrosine phosphorylation of SHC. Upon phosphorylation, SHC interacts with another adapter protein, Grb2, which binds to the Ras GTP/GDP exchange factor mSOS which leads to Ras activation. SHC is composed of an N-terminal domain that interacts with proteins containing phosphorylated tyrosines, a (glycine/proline)-rich collagen-homology domain that contains the phosphorylated binding site, and a C-terminal SH2 domain. SH2 has been shown to interact with the tyrosine-phosphorylated receptors of EGF and PDGF and with the tyrosine-phosphorylated C chain of the T-cell receptor, providing one of the mechanisms of T-cell-mediated Ras activation. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 104 |
| >gnl|CDD|214585 smart00252, SH2, Src homology 2 domains | Back alignment and domain information |
|---|
| >gnl|CDD|215658 pfam00017, SH2, SH2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast Cancer Anti-estrogen Resistance protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) | Back alignment and domain information |
|---|
| >gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family | Back alignment and domain information |
|---|
| >gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in SH2B adapter protein family | Back alignment and domain information |
|---|
| >gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family | Back alignment and domain information |
|---|
| >gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck | Back alignment and domain information |
|---|
| >gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in B-cell linker (BLNK) protein and SH2 domain-containing leukocyte protein of 76 kDa (SLP-76) | Back alignment and domain information |
|---|
| >gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck | Back alignment and domain information |
|---|
| >gnl|CDD|198273 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) | Back alignment and domain information |
|---|
| >gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198275 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| cd00173 | 94 | SH2 Src homology 2 domains; Signal transduction, i | 99.88 | |
| smart00252 | 84 | SH2 Src homology 2 domains. Src homology 2 domains | 99.85 | |
| PF00017 | 77 | SH2: SH2 domain; InterPro: IPR000980 The Src homol | 99.84 | |
| KOG4637|consensus | 464 | 99.75 | ||
| KOG4226|consensus | 379 | 99.74 | ||
| KOG4792|consensus | 293 | 99.73 | ||
| KOG0790|consensus | 600 | 99.68 | ||
| KOG1264|consensus | 1267 | 99.68 | ||
| KOG4278|consensus | 1157 | 99.65 | ||
| KOG1264|consensus | 1267 | 99.61 | ||
| KOG4637|consensus | 464 | 99.59 | ||
| KOG2996|consensus | 865 | 99.55 | ||
| KOG0197|consensus | 468 | 99.53 | ||
| KOG0194|consensus | 474 | 99.51 | ||
| KOG0790|consensus | 600 | 99.23 | ||
| KOG1930|consensus | 483 | 99.22 | ||
| KOG3601|consensus | 222 | 99.08 | ||
| KOG3697|consensus | 345 | 99.07 | ||
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 98.23 | |
| KOG3751|consensus | 622 | 98.0 | ||
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 96.61 | |
| KOG4566|consensus | 258 | 96.48 | ||
| KOG1856|consensus | 1299 | 96.13 | ||
| KOG1856|consensus | 1299 | 96.03 | ||
| PF02762 | 86 | Cbl_N3: CBL proto-oncogene N-terminus, SH2-like do | 89.99 | |
| smart00557 | 93 | IG_FLMN Filamin-type immunoglobulin domains. These | 82.9 |
| >cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) | Back alignment and domain information |
|---|
Probab=99.88 E-value=1.9e-21 Score=113.53 Aligned_cols=85 Identities=35% Similarity=0.505 Sum_probs=70.0
Q ss_pred CChHHHHhcccC-CCCcEEEEeeCCCCCCEEEEEEeCCeEEEEEEE-CCCCeEEeC-CcccCCHHHHHHHHhhCCcCccc
Q psy8455 1 MSRIAKTAFPSR-QDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLI-DPEGVVRTK-DRMFESVSHLVNYHCQNQLPIIS 77 (101)
Q Consensus 1 isR~~a~~~Ll~-~~G~FLvR~s~~~~g~~~Lsv~~~~~~~h~~I~-~~~~~~~~~-~~~F~sl~~LI~~y~~~~~~l~~ 77 (101)
|+|++|++.|.. ++|+||||.|.+.++.|+||++.++.++|++|. ..++++... ...|+||.|||+||+.+++ .
T Consensus 7 i~r~~Ae~~L~~~~~G~FLiR~s~~~~~~~~Lsv~~~~~v~H~~I~~~~~~~~~~~~~~~f~sl~eLv~~y~~~~~---~ 83 (94)
T cd00173 7 ISREEAEELLKKKPDGTFLVRDSESSPGDYVLSVRVKGKVKHYRIERTDDGYYLLGEGRSFPSLPELIEHYQKNPL---S 83 (94)
T ss_pred CCHHHHHHHHhcCCCceEEEEecCCCCCCEEEEEEECCEEEEEEEEECCCCeEEecCCCccCCHHHHHHHHhhCcc---C
Confidence 789996555543 799999999998789999999999999999997 445555554 6899999999999999885 2
Q ss_pred cCcceEEcCcc
Q psy8455 78 AESALILRNPV 88 (101)
Q Consensus 78 ~~~~~~L~~Pv 88 (101)
....+.|..|+
T Consensus 84 ~~~~~~L~~p~ 94 (94)
T cd00173 84 DGLGVKLRYPV 94 (94)
T ss_pred CCcccEeCCcC
Confidence 34567888886
|
SH2 domains typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. |
| >smart00252 SH2 Src homology 2 domains | Back alignment and domain information |
|---|
| >PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG1930|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >KOG3697|consensus | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >KOG4566|consensus | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >PF02762 Cbl_N3: CBL proto-oncogene N-terminus, SH2-like domain; InterPro: IPR014742 Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface | Back alignment and domain information |
|---|
| >smart00557 IG_FLMN Filamin-type immunoglobulin domains | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 101 | ||||
| 1mil_A | 104 | Transforming Protein Length = 104 | 2e-26 | ||
| 1tce_A | 107 | Solution Nmr Structure Of The Shc Sh2 Domain Comple | 2e-26 | ||
| 2kk6_A | 116 | Solution Structure Of Sh2 Domain Of Proto-Oncogene | 1e-10 | ||
| 3cd3_A | 377 | Crystal Structure Of Phosphorylated Human Feline Sa | 6e-05 | ||
| 3bkb_A | 377 | Crystal Structure Of Human Feline Sarcoma Viral Onc | 6e-05 | ||
| 1wqu_A | 114 | Solution Structure Of The Human Fes Sh2 Domain Leng | 3e-04 | ||
| 2lct_A | 107 | Solution Structure Of The Vav1 Sh2 Domain Complexed | 3e-04 | ||
| 2dly_A | 121 | Solution Structure Of The Sh2 Domain Of Murine Fyn- | 4e-04 | ||
| 1jyq_A | 96 | Xray Structure Of Grb2 Sh2 Domain Complexed With A | 4e-04 | ||
| 2crh_A | 138 | Solution Structure Of The Sh2 Domain Of Human Proto | 5e-04 | ||
| 1tze_E | 98 | Signal Transduction Adaptor Growth Factor, Grb2 Sh2 | 5e-04 | ||
| 3mxc_A | 101 | Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp | 5e-04 | ||
| 1cj1_A | 96 | Growth Factor Receptor Binding Protein Sh2 Domain ( | 5e-04 | ||
| 2aoa_A | 99 | Crystal Structures Of A High-affinity Macrocyclic P | 5e-04 | ||
| 1zfp_E | 98 | Growth Factor Receptor Binding Protein Sh2 Domain C | 5e-04 | ||
| 3n84_A | 112 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 6e-04 | ||
| 1ghu_A | 107 | Nmr Solution Structure Of Growth Factor Receptor-Bo | 6e-04 | ||
| 1x0n_A | 104 | Nmr Structure Of Growth Factor Receptor Binding Pro | 6e-04 | ||
| 1fhs_A | 112 | The Three-Dimensional Solution Structure Of The Src | 6e-04 | ||
| 3ove_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 6e-04 | ||
| 3imd_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 6e-04 | ||
| 1bmb_A | 123 | Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 | 6e-04 | ||
| 1bm2_A | 117 | Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet | 6e-04 | ||
| 1fyr_A | 114 | Dimer Formation Through Domain Swapping In The Crys | 6e-04 | ||
| 2h46_E | 116 | Native Domain-Swapped Dimer Crystal Structure Of Th | 6e-04 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 7e-04 |
| >pdb|1MIL|A Chain A, Transforming Protein Length = 104 | Back alignment and structure |
|
| >pdb|1TCE|A Chain A, Solution Nmr Structure Of The Shc Sh2 Domain Complexed With A Tyrosine-Phosphorylated Peptide From The T-Cell Receptor, Minimized Average Structure Length = 107 | Back alignment and structure |
| >pdb|2KK6|A Chain A, Solution Structure Of Sh2 Domain Of Proto-Oncogene Tyrosine- Protein Kinase Fer From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr3461d Length = 116 | Back alignment and structure |
| >pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 | Back alignment and structure |
| >pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 | Back alignment and structure |
| >pdb|1WQU|A Chain A, Solution Structure Of The Human Fes Sh2 Domain Length = 114 | Back alignment and structure |
| >pdb|2LCT|A Chain A, Solution Structure Of The Vav1 Sh2 Domain Complexed With A Syk-Derived Doubly Phosphorylated Peptide Length = 107 | Back alignment and structure |
| >pdb|2DLY|A Chain A, Solution Structure Of The Sh2 Domain Of Murine Fyn-Related Kinase Length = 121 | Back alignment and structure |
| >pdb|1JYQ|A Chain A, Xray Structure Of Grb2 Sh2 Domain Complexed With A Highly Affine Phospho Peptide Length = 96 | Back alignment and structure |
| >pdb|2CRH|A Chain A, Solution Structure Of The Sh2 Domain Of Human Proto- Oncogene Protein Vav1 Length = 138 | Back alignment and structure |
| >pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 | Back alignment and structure |
| >pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 | Back alignment and structure |
| >pdb|1CJ1|A Chain A, Growth Factor Receptor Binding Protein Sh2 Domain (Human) Complexed With A Phosphotyrosyl Derivative Length = 96 | Back alignment and structure |
| >pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 | Back alignment and structure |
| >pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 | Back alignment and structure |
| >pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 | Back alignment and structure |
| >pdb|1GHU|A Chain A, Nmr Solution Structure Of Growth Factor Receptor-Bound Protein 2 (Grb2) Sh2 Domain, 24 Structures Length = 107 | Back alignment and structure |
| >pdb|1X0N|A Chain A, Nmr Structure Of Growth Factor Receptor Binding Protein Sh2 Domain Complexed With The Inhibitor Length = 104 | Back alignment and structure |
| >pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 | Back alignment and structure |
| >pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 | Back alignment and structure |
| >pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 | Back alignment and structure |
| >pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 | Back alignment and structure |
| >pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 | Back alignment and structure |
| >pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 | Back alignment and structure |
| >pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 | Back alignment and structure |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 101 | |||
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 7e-32 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 3e-28 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 2e-25 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 5e-25 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 7e-25 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 8e-23 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 3e-21 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 5e-21 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 9e-21 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 2e-20 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 2e-18 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 8e-18 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 1e-07 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 2e-17 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 8e-17 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 9e-17 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 3e-16 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 3e-16 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 2e-15 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 3e-15 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 4e-15 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 2e-14 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 2e-14 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 4e-14 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 8e-14 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 8e-09 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 2e-13 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 3e-13 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 6e-13 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 2e-12 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 2e-12 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 3e-12 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 5e-12 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 6e-12 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 1e-11 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 2e-11 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 3e-11 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 4e-09 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 3e-11 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 4e-11 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 5e-11 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 5e-11 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 8e-11 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 9e-11 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 1e-10 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 2e-10 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 6e-10 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 3e-10 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 3e-10 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 3e-10 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 3e-10 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 3e-10 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 5e-10 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 2e-09 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 8e-10 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 1e-09 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 1e-09 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 1e-09 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 2e-09 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 3e-09 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 4e-09 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 7e-09 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 8e-09 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 8e-09 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 1e-08 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 3e-08 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 6e-08 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 6e-06 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 1e-05 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 1e-05 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 3e-05 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 1e-04 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 8e-04 |
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 | Back alignment and structure |
|---|
Score = 106 bits (267), Expect = 7e-32
Identities = 54/79 (68%), Positives = 62/79 (78%)
Query: 12 RQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQN 71
+ +GDFLVRES +PGQYVLTG Q G KHLLL+DPEGVVRTKD FESVSHL++YH N
Sbjct: 24 QLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDN 83
Query: 72 QLPIISAESALILRNPVAK 90
LPIISA S L L+ PV +
Sbjct: 84 HLPIISAGSELCLQQPVER 102
|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 99.96 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 99.95 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.94 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 99.94 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 99.94 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 99.94 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 99.93 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 99.93 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 99.93 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 99.93 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 99.93 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 99.93 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 99.93 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 99.93 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 99.93 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 99.93 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 99.93 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 99.93 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 99.93 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 99.93 | |
| 2lnw_A | 122 | VAV-2, guanine nucleotide exchange factor VAV2; si | 99.93 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 99.93 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.92 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 99.92 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 99.92 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 99.92 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 99.92 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 99.92 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 99.92 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.92 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 99.92 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 99.92 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 99.92 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 99.91 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 99.91 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 99.91 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 99.91 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 99.91 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 99.9 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 99.9 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 99.9 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 99.9 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 99.9 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 99.89 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.88 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 99.88 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 99.88 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 99.88 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.88 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.88 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 99.88 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 99.87 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.87 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.87 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 99.87 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.87 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.86 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 99.86 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.86 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.86 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.84 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.84 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.83 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.83 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.83 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 99.71 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.82 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.81 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.8 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.8 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.79 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.78 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.77 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.74 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 99.72 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.71 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.67 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.66 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.66 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.63 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.62 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.58 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 99.54 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.48 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 98.74 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 98.28 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 98.19 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 97.97 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 97.36 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 97.28 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 97.12 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 96.82 | |
| 3bux_B | 329 | E3 ubiquitin-protein ligase CBL; TKB, signal trans | 96.77 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 96.6 | |
| 3op0_A | 323 | Signal transduction protein CBL-C; structural geno | 96.47 | |
| 2w0p_A | 94 | Filamin-A; alternative splicing, cytoskeleton/comp | 89.72 | |
| 2di8_A | 111 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 88.92 | |
| 2bp3_A | 97 | Filamin A; structural protein, cytoskeleton/comple | 88.77 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 88.77 | |
| 3rgh_A | 100 | Filamin-A; cell adhesion, cytoskeleton-complex, di | 87.87 | |
| 2dic_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 87.58 | |
| 2eea_A | 115 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 87.29 | |
| 1v05_A | 96 | Filamin C; actin-binding protein, immunoglobulin; | 87.16 | |
| 2dia_A | 113 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 86.86 | |
| 2k9u_A | 119 | Gamma filamin; cytoskeletal complex, alternative s | 86.78 | |
| 3cnk_A | 89 | Filamin-A; FLNA24, X-RAY crystalography, homodimer | 86.44 | |
| 2dmb_A | 124 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 85.95 | |
| 2ds4_A | 113 | Tripartite motif protein 45; beta-sandwich, immuno | 85.59 | |
| 2di7_A | 124 | BK158_1; beta-sandwich, immunoglobulin-like fold, | 84.32 | |
| 2di9_A | 131 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 84.09 | |
| 2ee6_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 83.98 | |
| 2dj4_A | 108 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 83.3 | |
| 2d7o_A | 111 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 82.7 | |
| 2d7m_A | 115 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 82.68 | |
| 2e9j_A | 119 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 82.09 |
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* | Back alignment and structure |
|---|
Probab=99.96 E-value=9.7e-29 Score=146.75 Aligned_cols=91 Identities=62% Similarity=0.924 Sum_probs=81.6
Q ss_pred CChHHHHhcccCCCCcEEEEeeCCCCCCEEEEEEeCCeEEEEEEECCCCeEEeCCcccCCHHHHHHHHhhCCcCccccCc
Q psy8455 1 MSRIAKTAFPSRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQNQLPIISAES 80 (101)
Q Consensus 1 isR~~a~~~Ll~~~G~FLvR~s~~~~g~~~Lsv~~~~~~~h~~I~~~~~~~~~~~~~F~sl~~LI~~y~~~~~~l~~~~~ 80 (101)
|+|++| +.||.++|+||||+|++.+|.|+||++.++.++||+|...+|.|.+++..|+||.+||+||+.+++|+.+.+.
T Consensus 14 isR~~A-e~lL~~~G~FLVR~S~~~~g~~~LSv~~~~~v~H~~I~~~~g~~~~~~~~F~sl~~LI~~y~~~~~p~~~~g~ 92 (104)
T 1mil_A 14 LSRREA-EALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGS 92 (104)
T ss_dssp CCHHHH-HTTCCSTTEEEEEECCSSCSSEEEEEEETTEEEEEEEBCTTSSEECSSCEESSHHHHHHHHHHHTCCEEETTE
T ss_pred CCHHHH-HHHhccCCcEEEEeCCCCCCCEEEEEEECCEEEEEEEEeCCCEEEECCceeCCHHHHHHHHhhCCCccccCCc
Confidence 789995 5555689999999999989999999999999999999877788989889999999999999999998866677
Q ss_pred ceEEcCccccCC
Q psy8455 81 ALILRNPVAKCA 92 (101)
Q Consensus 81 ~~~L~~Pv~~~~ 92 (101)
.+.|+.||+|++
T Consensus 93 ~~~L~~Pv~r~~ 104 (104)
T 1mil_A 93 ELCLQQPVERKL 104 (104)
T ss_dssp EECCCEECCCCC
T ss_pred eEEeCccCCCCC
Confidence 889999999864
|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 | Back alignment and structure |
|---|
| >3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} | Back alignment and structure |
|---|
| >2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A | Back alignment and structure |
|---|
| >2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} SCOP: b.1.18.0 | Back alignment and structure |
|---|
| >2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A | Back alignment and structure |
|---|
| >2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 101 | ||||
| d1mila_ | 104 | d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap | 2e-23 | |
| d1fu6a_ | 111 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 4e-16 | |
| d2shpa2 | 109 | d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma | 2e-15 | |
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 5e-15 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 9e-15 | |
| d1nrva_ | 105 | d.93.1.1 (A:) Growth factor receptor-bound protein | 5e-14 | |
| d2qmsa1 | 113 | d.93.1.1 (A:420-532) Growth factor receptor-bound | 6e-14 | |
| d1k9aa2 | 101 | d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( | 9e-14 | |
| d1d4ta_ | 104 | d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap | 2e-13 | |
| d1qada_ | 107 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 5e-13 | |
| d2shpa3 | 108 | d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu | 6e-13 | |
| d1rpya_ | 86 | d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor | 7e-13 | |
| d1jwoa_ | 97 | d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho | 2e-12 | |
| d1rjaa_ | 100 | d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu | 2e-12 | |
| d1i3za_ | 103 | d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat | 6e-12 | |
| d1a81a1 | 129 | d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom | 2e-11 | |
| d2oq1a1 | 130 | d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 | 2e-11 | |
| d2eyva1 | 109 | d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo | 3e-11 | |
| d1opka2 | 101 | d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M | 3e-11 | |
| d2cs0a1 | 106 | d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai | 3e-11 | |
| d2izva2 | 112 | d.93.1.1 (A:274-385) Suppressor of cytokine signal | 6e-11 | |
| d2fcia1 | 105 | d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B | 2e-10 | |
| d2c9wa2 | 103 | d.93.1.1 (A:32-134) Suppressor of cytokine signali | 4e-10 | |
| d2oq1a2 | 124 | d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 | 5e-10 | |
| d1g83a2 | 104 | d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H | 5e-10 | |
| d1lkka_ | 105 | d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo | 5e-10 | |
| d1o48a_ | 106 | d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s | 9e-10 | |
| d1xa6a2 | 141 | d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom | 4e-09 | |
| d1blja_ | 114 | d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou | 7e-09 | |
| d1qcfa2 | 103 | d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H | 8e-09 | |
| d1a81a2 | 125 | d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H | 2e-08 | |
| d1luia_ | 108 | d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou | 2e-07 | |
| d1bg1a3 | 141 | d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) | 9e-07 | |
| d1uura3 | 131 | d.93.1.1 (A:577-707) STAT homologue {Dictyostelium | 7e-06 |
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: SH2-like superfamily: SH2 domain family: SH2 domain domain: Shc adaptor protein species: Human (Homo sapiens) [TaxId: 9606]
Score = 83.9 bits (207), Expect = 2e-23
Identities = 54/79 (68%), Positives = 62/79 (78%)
Query: 12 RQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQN 71
+ +GDFLVRES +PGQYVLTG Q G KHLLL+DPEGVVRTKD FESVSHL++YH N
Sbjct: 24 QLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDN 83
Query: 72 QLPIISAESALILRNPVAK 90
LPIISA S L L+ PV +
Sbjct: 84 HLPIISAGSELCLQQPVER 102
|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 101 | |||
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 99.96 | |
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 99.94 | |
| d1rjaa_ | 100 | Tyrosine-protein kinase 6 (Breast tumor kinase, Br | 99.94 | |
| d1k9aa2 | 101 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.94 | |
| d1opka2 | 101 | Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: | 99.94 | |
| d2shpa2 | 109 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.93 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.93 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.93 | |
| d2fcia1 | 105 | Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: | 99.93 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 99.92 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 99.92 | |
| d1qcfa2 | 103 | Hemopoetic cell kinase Hck {Human (Homo sapiens) [ | 99.92 | |
| d1a81a2 | 125 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.91 | |
| d1d4ta_ | 104 | The Xlp protein Sap {Human (Homo sapiens) [TaxId: | 99.91 | |
| d1lkka_ | 105 | p56-lck tyrosine kinase {Human (Homo sapiens) [Tax | 99.91 | |
| d2oq1a2 | 124 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.91 | |
| d2eyva1 | 109 | Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 | 99.91 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 99.91 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 99.91 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 99.91 | |
| d1qada_ | 107 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.91 | |
| d2izva2 | 112 | Suppressor of cytokine signaling 4, SOCS-4 {Human | 99.9 | |
| d2shpa3 | 108 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.9 | |
| d1o48a_ | 106 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.9 | |
| d1blja_ | 114 | P55 Blk protein tyrosine kinase {Mouse (Mus muscul | 99.9 | |
| d2cs0a1 | 106 | Hematopoietic SH2 domain containing protein HSH2D | 99.9 | |
| d1g83a2 | 104 | Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: | 99.89 | |
| d1fu6a_ | 111 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.88 | |
| d1luia_ | 108 | Itk/tsk protein tyrosine kinase {Mouse (Mus muscul | 99.88 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 99.86 | |
| d2c9wa2 | 103 | Suppressor of cytokine signaling 2, SOCS-2 {Human | 99.85 | |
| d1xa6a2 | 141 | Beta-chimaerin, N-terminal domain {Human (Homo sap | 99.8 | |
| d1uura3 | 131 | STAT homologue {Dictyostelium discoideum [TaxId: 4 | 99.45 | |
| d1bg1a3 | 141 | STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | 99.4 | |
| d1bf5a3 | 142 | STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | 97.56 | |
| d3buxb3 | 88 | Cbl {Human (Homo sapiens) [TaxId: 9606]} | 91.58 | |
| d2w0pa1 | 92 | Filamin a {Human (Homo sapiens) [TaxId: 9606]} | 84.95 | |
| d1wlha1 | 101 | F-actin cross-linking gelation factor (ABP-120) re | 83.28 | |
| d2dica1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 81.34 | |
| d2di8a1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 81.07 | |
| d2diaa1 | 100 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 80.26 | |
| d2dj4a1 | 101 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 80.2 |
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: SH2-like superfamily: SH2 domain family: SH2 domain domain: Shc adaptor protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.96 E-value=3e-29 Score=147.60 Aligned_cols=90 Identities=62% Similarity=0.939 Sum_probs=81.7
Q ss_pred CChHHHHhcccCCCCcEEEEeeCCCCCCEEEEEEeCCeEEEEEEECCCCeEEeCCcccCCHHHHHHHHhhCCcCccccCc
Q psy8455 1 MSRIAKTAFPSRQDGDFLVRESQGSPGQYVLTGYQGGTKKHLLLIDPEGVVRTKDRMFESVSHLVNYHCQNQLPIISAES 80 (101)
Q Consensus 1 isR~~a~~~Ll~~~G~FLvR~s~~~~g~~~Lsv~~~~~~~h~~I~~~~~~~~~~~~~F~sl~~LI~~y~~~~~~l~~~~~ 80 (101)
|+|++| +.||+++|+||||.|++.+|.|+||+++++.++||+|...+|.|.+++..|+||.|||+||+.+++++.+.+.
T Consensus 14 i~R~~A-e~lL~~~G~FLVR~S~~~~g~~vLSv~~~~~v~H~~I~~~~~~~~~~~~~F~sl~~LV~~y~~~~~~~~~~~~ 92 (104)
T d1mila_ 14 LSRREA-EALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEGVVRTKDHRFESVSHLISYHMDNHLPIISAGS 92 (104)
T ss_dssp CCHHHH-HTTCCSTTEEEEEECCSSCSSEEEEEEETTEEEEEEEBCTTSSEECSSCEESSHHHHHHHHHHHTCCEEETTE
T ss_pred CCHHHH-HHHHhcCCcEEEEecCCCCCCEEEEEEEccccceEEEEeCCCEEEeCCeeECCHHHHHHHHhhCCCCcccCCc
Confidence 789995 5566889999999999989999999999999999999877788988889999999999999999999877777
Q ss_pred ceEEcCccccC
Q psy8455 81 ALILRNPVAKC 91 (101)
Q Consensus 81 ~~~L~~Pv~~~ 91 (101)
.+.|++||+|+
T Consensus 93 ~~~L~~Pi~R~ 103 (104)
T d1mila_ 93 ELCLQQPVERK 103 (104)
T ss_dssp EECCCEECCCC
T ss_pred ceEeCCCcCCc
Confidence 88899999885
|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3buxb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|