Diaphorina citri psyllid: psy8484


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
MIGVPRTRTKTIPIPYTETYMDEYCMRQSWYFTYHCQKTRTAYSYKYKTEEYMEDTHVRICCEGYEDDHGSCRPVCERECVFGSCTSPNQCTCSPGYVVINEASPNICEPHCAECVNGVCSAPNTCDCLDVL
cccccCEEEEEEECcCEEEEEccCEEEccCCccccccCEEEEEEccccccEEECccccEEcccccccccccccccccccccccEEcccccEEccccccccccccccccccccccccccEEcccccEEccccc
****PRTRTKTIPIPYTETYMDEYCMRQSWYFTYHCQKTRTAYSYKYKTEEYMEDTHVRICCEGYEDDHGSCRPVCERECVFGSCTSPNQCTCSPGYVVINEASPNICEPHCAECVNGVCSAPNTCDCLDVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGVPRTRTKTIPIPYTETYMDEYCMRQSWYFTYHCQKTRTAYSYKYKTEEYMEDTHVRICCEGYEDDHGSCRPVCERECVFGSCTSPNQCTCSPGYVVINEASPNICEPHCAECVNGVCSAPNTCDCLDVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0005604 [CC]basement membraneprobableGO:0005578, GO:0031012, GO:0005575, GO:0005576, GO:0044420, GO:0044421
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YGQ, chain A
Confidence level:confident
Coverage over the Query: 52-132
View the alignment between query and template
View the model in PyMOL