Psyllid ID: psy8484
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 132 | ||||||
| 170047324 | 772 | conserved hypothetical protein [Culex qu | 0.810 | 0.138 | 0.416 | 6e-12 | |
| 170044674 | 1363 | conserved hypothetical protein [Culex qu | 0.833 | 0.080 | 0.408 | 2e-11 | |
| 170047453 | 243 | conserved hypothetical protein [Culex qu | 0.886 | 0.481 | 0.369 | 9e-10 | |
| 383866271 | 2054 | PREDICTED: uncharacterized protein LOC10 | 0.575 | 0.037 | 0.487 | 1e-09 | |
| 340726449 | 2219 | PREDICTED: hypothetical protein LOC10064 | 0.856 | 0.050 | 0.365 | 2e-09 | |
| 195115802 | 244 | GI12725 [Drosophila mojavensis] gi|19391 | 0.522 | 0.282 | 0.464 | 3e-09 | |
| 198473238 | 706 | GA14817 [Drosophila pseudoobscura pseudo | 0.530 | 0.099 | 0.493 | 3e-09 | |
| 328780327 | 805 | PREDICTED: nimrod C2 [Apis mellifera] | 0.863 | 0.141 | 0.388 | 1e-08 | |
| 307191598 | 1352 | Putative EGF-like domain-containing prot | 0.840 | 0.082 | 0.365 | 1e-08 | |
| 157117458 | 1285 | hypothetical protein AaeL_AAEL007967 [Ae | 0.590 | 0.060 | 0.443 | 2e-08 |
| >gi|170047324|ref|XP_001851176.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167869762|gb|EDS33145.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 75.5 bits (184), Expect = 6e-12, Method: Compositional matrix adjust.
Identities = 50/120 (41%), Positives = 66/120 (55%), Gaps = 13/120 (10%)
Query: 15 PYTETYMDEYCMRQSW-----YFTYHCQKTRTAYSYKYKTEEYMEDTHVRICCEGYEDDH 69
PY ++ DEY R S +F H ++ Y K Y+ ++ + +CCEGY D
Sbjct: 24 PYVNSW-DEYVSRYSTCSYECFFISHHKQVHFGYYTKSCELAYLTESRL-VCCEGYFDYG 81
Query: 70 GSCRPVCERECVFGSCTSPNQCTCSPGYV-VINEASPNICEPHCAECVNGVCSAPNTCDC 128
G C PVC+ C G CT P+QCTC+ GYV V+NE C+P C+ C NG C APN C C
Sbjct: 82 GDCYPVCKSGCPNGRCTGPDQCTCNEGYVNVLNE-----CKPKCSSCENGRCVAPNECVC 136
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|170044674|ref|XP_001849964.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167867729|gb|EDS31112.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|170047453|ref|XP_001851235.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167869902|gb|EDS33285.1| conserved hypothetical protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|383866271|ref|XP_003708594.1| PREDICTED: uncharacterized protein LOC100879168 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340726449|ref|XP_003401570.1| PREDICTED: hypothetical protein LOC100644464 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|195115802|ref|XP_002002445.1| GI12725 [Drosophila mojavensis] gi|193913020|gb|EDW11887.1| GI12725 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|198473238|ref|XP_001356220.2| GA14817 [Drosophila pseudoobscura pseudoobscura] gi|198139366|gb|EAL33280.2| GA14817 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|328780327|ref|XP_394098.4| PREDICTED: nimrod C2 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307191598|gb|EFN75095.1| Putative EGF-like domain-containing protein FLJ14712 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|157117458|ref|XP_001658777.1| hypothetical protein AaeL_AAEL007967 [Aedes aegypti] gi|108876062|gb|EAT40287.1| AAEL007967-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 132 | ||||||
| FB|FBgn0028939 | 701 | nimC2 "nimrod C2" [Drosophila | 0.522 | 0.098 | 0.472 | 4.4e-14 | |
| FB|FBgn0028543 | 421 | nimB2 "nimrod B2" [Drosophila | 0.507 | 0.159 | 0.492 | 7.2e-14 | |
| MGI|MGI:1920432 | 1034 | Pear1 "platelet endothelial ag | 0.787 | 0.100 | 0.347 | 1.2e-12 | |
| FB|FBgn0260011 | 377 | nimC4 "nimrod C4" [Drosophila | 0.628 | 0.220 | 0.413 | 1.9e-12 | |
| FB|FBgn0259896 | 620 | nimC1 "nimrod C1" [Drosophila | 0.492 | 0.104 | 0.472 | 1.9e-12 | |
| FB|FBgn0243514 | 1054 | eater "eater" [Drosophila mela | 0.492 | 0.061 | 0.485 | 1.9e-12 | |
| UNIPROTKB|A6PVP2 | 173 | PEAR1 "Platelet endothelial ag | 0.787 | 0.601 | 0.321 | 2.4e-12 | |
| RGD|1305653 | 1033 | Pear1 "platelet endothelial ag | 0.765 | 0.097 | 0.330 | 8.2e-12 | |
| UNIPROTKB|Q5VY43 | 1037 | PEAR1 "Platelet endothelial ag | 0.787 | 0.100 | 0.321 | 5.9e-11 | |
| FB|FBgn0027929 | 402 | nimB1 "nimrod B1" [Drosophila | 0.492 | 0.161 | 0.422 | 7.5e-11 |
| FB|FBgn0028939 nimC2 "nimrod C2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 192 (72.6 bits), Expect = 4.4e-14, P = 4.4e-14
Identities = 34/72 (47%), Positives = 38/72 (52%)
Query: 61 CCEGYEDDHG--SCRPVCERECVFGSCTSPNQCTCSPGYVVINEASPNICEPHCAE-CVN 117
C GYED C P C C G C+SP C C PG+VV N + PN C P C E C+N
Sbjct: 514 CFAGYEDTKVPYECVPSCRPRCENGRCSSPGHCECDPGHVVTNSSEPNSCRPQCQEQCIN 573
Query: 118 GVCSAPNTCDCL 129
C AP C CL
Sbjct: 574 AECVAPEKCACL 585
|
|
| FB|FBgn0028543 nimB2 "nimrod B2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1920432 Pear1 "platelet endothelial aggregation receptor 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0260011 nimC4 "nimrod C4" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0259896 nimC1 "nimrod C1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0243514 eater "eater" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6PVP2 PEAR1 "Platelet endothelial aggregation receptor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1305653 Pear1 "platelet endothelial aggregation receptor 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5VY43 PEAR1 "Platelet endothelial aggregation receptor 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0027929 nimB1 "nimrod B1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 132 | |||
| PF07546 | 72 | EMI: EMI domain; InterPro: IPR011489 The EMI domai | 98.87 | |
| KOG1225|consensus | 525 | 98.8 | ||
| KOG1225|consensus | 525 | 98.47 | ||
| KOG4289|consensus | 2531 | 97.77 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 97.21 | |
| KOG1226|consensus | 783 | 97.19 | ||
| KOG1219|consensus | 4289 | 97.04 | ||
| KOG1214|consensus | 1289 | 96.68 | ||
| KOG1219|consensus | 4289 | 95.9 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 95.88 | |
| smart00051 | 63 | DSL delta serrate ligand. | 95.6 | |
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 95.5 | |
| KOG1226|consensus | 783 | 95.33 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 95.28 | |
| KOG4289|consensus | 2531 | 94.79 | ||
| smart00051 | 63 | DSL delta serrate ligand. | 93.26 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 90.68 | |
| KOG1214|consensus | 1289 | 88.13 | ||
| KOG1217|consensus | 487 | 87.37 | ||
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 86.39 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 86.2 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 83.3 | |
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 82.23 | |
| cd00054 | 38 | EGF_CA Calcium-binding EGF-like domain, present in | 80.05 | |
| KOG1217|consensus | 487 | 80.01 |
| >PF07546 EMI: EMI domain; InterPro: IPR011489 The EMI domain, first named after its presence in proteins of the EMILIN family, is a small cysteine-rich module of around 75 amino acids | Back alignment and domain information |
|---|
Probab=98.87 E-value=5.5e-09 Score=68.05 Aligned_cols=65 Identities=22% Similarity=0.355 Sum_probs=50.0
Q ss_pred cCCCCCeeeEEece-eeeeeeeeeee-eeeee-e-ecCCcceeEEEEEeeeeeeecCCCceEeCCCceeC
Q psy8484 3 GVPRTRTKTIPIPY-TETYMDEYCMR-QSWYF-T-YHCQKTRTAYSYKYKTEEYMEDTHVRICCEGYEDD 68 (132)
Q Consensus 3 ~vc~~~~~~~~v~~-~esy~qp~~~~-~~~~~-~-~~C~~~r~~~~~~~~~~~~~~~~~~c~C~~Gy~~~ 68 (132)
+||+.++ +..|+. +|+|.|||..+ +.|++ . ++|+.||+.|+..+|...+...+.+-.|||||.|.
T Consensus 3 nvC~~~~-~~~v~~~~~~~~q~~~~~~~~~C~~~~~~C~~yrt~yr~~Yr~~~k~~t~~~~~CCpGy~~~ 71 (72)
T PF07546_consen 3 NVCAYVV-TRTVSCKVESYVQPYVQPYYTPCWWGPPRCSRYRTVYRPAYRQVYKTVTRLEWRCCPGYSGT 71 (72)
T ss_pred ccCCcEe-EECccEEEEeCcEEEEecccccCCCCCCcCCceEEEeEEEEEEEEEEEccEeeeeCcCcccC
Confidence 6899875 333332 77777777665 44552 2 68999999999999998888888889999999986
|
The EMI domain is most often found at the N terminus of metazoan extracellular proteins that are forming or are compatible with multimer formation []. It is found in association with other domains, such as C1q, laminin-type EGF-like, collagen-like, FN3, WAP, ZP or FAS1 []. It has been suggested that the EMI domain could be a protein-protein interaction module, as the EMI domain of EMILIN-1 was found to interact with the C1q domain of EMILIN-2 []. The EMI domain possesses six highly conserved cysteines residues, which likely form disulphide bonds. Other key features of the EMI domain are the C-C-x-G-[WYFH] pattern, a hydrophobic position just preceding the first cysteine (Cys1) of the domain and a cluster of hydrophobic residues between Cys3 and Cys4. The EMI domain could be made of two sub-domains, the fold of the second one sharing similarities with the C-terminal sub-module characteristic of EGF-like domains []. Proteins known to contain a EMI domain include: Vertebrate Emilins, extracellular matrix glycoproteins. Vertebrate Multimerins, extracellular matrix glycoproteins. Vetebrate Emu proteins, which could interact with several different extracellular matrix components and serve to connect and integrate the function of multiple partner molecules. Vertebrate beta-IG-H3. Vertebrate osteoblast-specific factor 2 (OSF-2). Mammalian NEU1/NG3 proteins. Drosophila midline fasciclin. Caenorhabditis elegans ced-1, a transmembrane receptor that mediates cell corpse engulfment. The Pfam alignment for this domain is truncated at the C terminus and does not include the final cysteine []. This is to stop the family overlapping with other domains.; GO: 0005515 protein binding |
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 132 | |||
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 2e-06 |
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 | Back alignment and structure |
|---|
Score = 44.6 bits (105), Expect = 2e-06
Identities = 23/67 (34%), Positives = 26/67 (38%), Gaps = 3/67 (4%)
Query: 62 CEGYEDDHGSCRPVCERECVFGSCTSPNQCTCSPGYVVINEASPNICEPHCAECVNGVCS 121
C + C R C G CT +C CSPG+ CEP C GVC
Sbjct: 381 CRATVQPAQTLTSECSRLCRNGYCTPTGKCCCSPGWEGDF-CRTAKCEPACRH--GGVCV 437
Query: 122 APNTCDC 128
PN C C
Sbjct: 438 RPNKCLC 444
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 132 | |||
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.12 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.0 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.96 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 98.94 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.9 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.59 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 98.48 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.46 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.46 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.37 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 98.35 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.34 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.32 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.29 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.25 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 98.17 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.14 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 98.12 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.09 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.09 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.99 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 97.78 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.75 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 97.71 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 97.61 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 97.54 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 97.25 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.18 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 97.14 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.08 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.02 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.0 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 97.0 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 96.97 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 96.95 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 96.84 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 96.8 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 96.78 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 96.71 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 96.67 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 96.66 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 96.44 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 96.39 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 96.11 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 96.03 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 95.91 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 95.88 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 95.87 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 95.83 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 95.36 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 95.1 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 95.08 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 95.07 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 94.93 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 94.92 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 94.81 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 94.04 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 93.89 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 93.84 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 93.8 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 93.63 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 93.53 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 93.52 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 93.09 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 92.99 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 92.83 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 92.69 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 92.37 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 92.33 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 92.32 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 92.13 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 92.11 | |
| 2p26_A | 280 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 91.59 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 91.35 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 91.25 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 90.66 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 90.56 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 90.54 | |
| 2ddu_A | 387 | Reelin; beta-jelly-roll, signaling protein; 2.05A | 90.11 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 90.05 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 89.55 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 89.43 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 89.0 | |
| 2fd6_A | 122 | Urokinase-type plasminogen activator; UPAR, ATF, A | 88.94 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 88.69 | |
| 2i9a_A | 145 | Urokinase-type plasminogen activator; growth facto | 88.49 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 88.4 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 87.65 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 87.42 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 87.05 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 86.57 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 85.96 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 85.75 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 85.32 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 84.56 | |
| 1n1i_A | 105 | Merozoite surface protein-1; MSP1, malaria, surfac | 81.9 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 81.61 | |
| 1g1s_A | 162 | P-selectin; selectin, lectin, EGF, sulphated, SLEX | 81.49 | |
| 3nt1_A | 587 | Prostaglandin-endoperoxide synthase 2; prostagland | 81.28 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 80.25 | |
| 1q4g_A | 553 | Prostaglandin G/H synthase 1; cyclooxygenase, non- | 80.04 |
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.12 E-value=1e-10 Score=93.98 Aligned_cols=76 Identities=28% Similarity=0.813 Sum_probs=60.0
Q ss_pred eecCCCceEeCCCceeCCCceecccCCCCCC-cEEcCCCeEEccCCceeccCCCCCccccCCCCCC-CCEEcCCCceeCC
Q psy8484 52 YMEDTHVRICCEGYEDDHGSCRPVCERECVF-GSCTSPNQCTCSPGYVVINEASPNICEPHCAECV-NGVCSAPNTCDCL 129 (132)
Q Consensus 52 ~~~~~~~c~C~~Gy~~~~~~C~~~C~~~C~n-G~C~~p~~C~C~~G~~G~~~c~~~~C~~~C~~C~-nG~C~~p~~C~C~ 129 (132)
.+...+.|.|.+||+|...+ .+.|..+|.| |.|+.++.|.|++||.|.. |+...|.. .|. +|+|+.+++|.|+
T Consensus 160 ~C~~~~~C~C~~G~~G~~C~-~~~C~~~C~~~G~C~~~~~C~C~~G~~G~~-C~~~~C~~---~C~~~G~C~~~~~C~C~ 234 (324)
T 2ygq_A 160 FCNERRICECPDGFHGPHCE-KALCTPRCMNGGLCVTPGFCICPPGFYGVN-CDKANCST---TCFNGGTCFYPGKCICP 234 (324)
T ss_dssp EECTTSCEECCTTEESSSSC-EESSSSCCCTTCEECSSCCEECCTTCBTTT-TCBCCCSS---CCCSSCCBSCSSCBCCC
T ss_pred EECCCCeEECCCCCcCCCCC-CCCCCCCCCCCCEEcCCCEEeCCCCccCCC-cccCcCCC---CCCCCCeeCCCCeeeCC
Confidence 34446789999999997543 5678888985 9999999999999999987 76555543 555 4788888889998
Q ss_pred CCC
Q psy8484 130 DVL 132 (132)
Q Consensus 130 ~G~ 132 (132)
+||
T Consensus 235 ~G~ 237 (324)
T 2ygq_A 235 PGL 237 (324)
T ss_dssp TTC
T ss_pred CCc
Confidence 887
|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >2p26_A Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 1.75A {Homo sapiens} PDB: 1yuk_B* 1yuk_A* 2p28_A* | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2ddu_A Reelin; beta-jelly-roll, signaling protein; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >2i9a_A Urokinase-type plasminogen activator; growth factor-like domain, kringle domain, hydrolase; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 2i9b_A* | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A | Back alignment and structure |
|---|
| >3nt1_A Prostaglandin-endoperoxide synthase 2; prostaglandin H2 synthase, cyclooxygenase-2, naproxen, oxido; HET: NAG BOG NPS HEM; 1.73A {Mus musculus} PDB: 3ln1_A* 3mqe_A* 3ln0_A* 3ntb_A* 3q7d_A* 4fm5_A* 1pxx_A* 3pgh_A* 1cx2_A* 4cox_A* 5cox_A* 6cox_A* 3qh0_A* 3qmo_A* 4e1g_A* 3olu_A* 3olt_A* 3hs5_A* 3hs6_A* 3hs7_A* ... | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1q4g_A Prostaglandin G/H synthase 1; cyclooxygenase, non-steroidal anti-inflammatory drug, peroxi prostaglandin synthase, EGF-like domain; HET: BOG NAG NDG BMA MAN BFL HEM; 2.00A {Ovis aries} SCOP: a.93.1.2 g.3.11.1 PDB: 1diy_A* 2ayl_A* 3kk6_A* 3n8v_A* 3n8w_A* 3n8x_A* 3n8y_A* 3n8z_A* 2oyu_P* 2oye_P* 1eqg_A* 1cqe_A* 1eqh_A* 1igz_A* 1igx_A* 1fe2_A* 1pge_A* 1pgf_A* 1pgg_A* 3n8w_B* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 132 | |||
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.01 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 96.93 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 96.86 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 96.7 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 96.68 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.5 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 96.45 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.41 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 96.15 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 96.08 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 95.89 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 95.81 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 95.71 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 95.69 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 95.66 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 94.94 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 94.65 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 94.49 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 94.4 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 94.38 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 93.72 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 93.56 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 92.97 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 92.91 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 92.68 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 92.24 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 91.76 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 91.56 | |
| d1jv2b5 | 43 | Integrin beta EGF-like domains {Human (Homo sapien | 91.18 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 91.03 | |
| d1jv2b4 | 31 | Integrin beta EGF-like domains {Human (Homo sapien | 90.25 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 89.82 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 89.74 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 89.61 | |
| d1emoa2 | 39 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 89.09 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 88.02 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 86.89 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 86.54 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 83.56 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 82.44 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 80.14 |
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Neurogenic locus notch homolog protein 1, Notch1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.01 E-value=0.00016 Score=39.66 Aligned_cols=27 Identities=30% Similarity=0.735 Sum_probs=21.9
Q ss_pred CCCCC-cEEcC---CCeEEccCCceeccCCCC
Q psy8484 78 RECVF-GSCTS---PNQCTCSPGYVVINEASP 105 (132)
Q Consensus 78 ~~C~n-G~C~~---p~~C~C~~G~~G~~~c~~ 105 (132)
.+|+| |+|+. ..+|.|.+||.|.. |+.
T Consensus 7 ~PC~n~g~C~~~~~~y~C~C~~G~~G~~-Ce~ 37 (39)
T d2vj3a2 7 NPCQNDATCLDQIGEFQCICMPGYEGVH-CEV 37 (39)
T ss_dssp CCCCSSCEEEECSSCEEEECCTTEESSS-SCE
T ss_pred CCCCCCCEEECCCCCEEEeCCCCCccCc-Cee
Confidence 58997 89973 46899999999997 553
|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|