Diaphorina citri psyllid: psy8491


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MGLDYITMDEYLLSVIQSTSMSQDLRQAVICRFDLKFVNASYCAPVCSSPCINGACVFPEQCHCSPGFQFVNETYCEPYCENCQHGTCTAPSVCECESGFVHNNETNACERICEEPKPPLYPGLGTIPNTERTCLDNKCHCSEGDSNPYCIIQCDVGYTLNPRTLYCEPECFNCTRGYCLEPNECSCPYNFHLEGGMCMIAEGFHTLYSELVDMYRKKVLFLSCQYDLENQTDISRVDMARFNLDTYEVVRCIYNASVNRTCETQCDLEQVKL
ccccccccccEEEccccccccccccccccEEcccccccccccccccccccccccEEcccccEEccccccccccccccccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccEEcccccECccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MGLDYITMDEYLLSVIQSTSMSQDLRQAVICRFDLKFVNASYCAPVCSSPCINGACVFPEQCHCSPGFQFVNETYCEPYCENCQHGTCTAPSVCECESGFVHNNETNACERICEEPKPPLYPGLGTIPNTERTCLDNKCHCSEGDSNPYCIIQCDVGYTLNPRTLYCEPECFNCTRGYCLEPNECSCPYNFHLEGGMCMIAEGFHTLYSELVDMYRKKVLFLSCQYDLENQTDISRVDMARFNLDTYEVVRCIYNASVNRTCETQCDL**V**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLDYITMDEYLLSVIQSTSMSQDLRQAVICRFDLKFVNASYCAPVCSSPCINGACVFPEQCHCSPGFQFVNETYCEPYCENCQHGTCTAPSVCECESGFVHNNETNACERICEEPKPPLYPGLGTIPNTERTCLDNKCHCSEGDSNPYCIIQCDVGYTLNPRTLYCEPECFNCTRGYCLEPNECSCPYNFHLEGGMCMIAEGFHTLYSELVDMYRKKVLFLSCQYDLENQTDISRVDMARFNLDTYEVVRCIYNASVNRTCETQCDLEQVKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0070887 [BP]cellular response to chemical stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0042221, GO:0044699
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0045597 [BP]positive regulation of cell differentiationprobableGO:0051094, GO:0050793, GO:0050794, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0031323 [BP]regulation of cellular metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222, GO:0050794
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0048583 [BP]regulation of response to stimulusprobableGO:0008150, GO:0065007, GO:0050789
GO:0009719 [BP]response to endogenous stimulusprobableGO:0050896, GO:0008150
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YGQ, chain A
Confidence level:very confident
Coverage over the Query: 45-139
View the alignment between query and template
View the model in PyMOL
Template: 2VJ2, chain A
Confidence level:very confident
Coverage over the Query: 31-132,153-200
View the alignment between query and template
View the model in PyMOL
Template: 2DTG, chain E
Confidence level:probable
Coverage over the Query: 11-203
View the alignment between query and template
View the model in PyMOL