Psyllid ID: psy8491
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 273 | ||||||
| 307191598 | 1352 | Putative EGF-like domain-containing prot | 0.534 | 0.107 | 0.362 | 6e-15 | |
| 270009253 | 436 | nimrod-like protein [Tribolium castaneum | 0.597 | 0.373 | 0.390 | 3e-14 | |
| 158298665 | 920 | AGAP009763-PA [Anopheles gambiae str. PE | 0.597 | 0.177 | 0.314 | 1e-12 | |
| 322778999 | 630 | hypothetical protein SINV_02780 [Solenop | 0.534 | 0.231 | 0.375 | 1e-12 | |
| 195579142 | 701 | GD23945 [Drosophila simulans] gi|1941914 | 0.446 | 0.174 | 0.361 | 2e-12 | |
| 195338359 | 701 | GM15452 [Drosophila sechellia] gi|194129 | 0.446 | 0.174 | 0.361 | 2e-12 | |
| 195397752 | 399 | GJ18075 [Drosophila virilis] gi|19414114 | 0.582 | 0.398 | 0.342 | 4e-12 | |
| 357613215 | 806 | hypothetical protein KGM_14926 [Danaus p | 0.556 | 0.188 | 0.282 | 5e-12 | |
| 195473957 | 701 | GE19018 [Drosophila yakuba] gi|194175359 | 0.567 | 0.221 | 0.342 | 5e-12 | |
| 28574164 | 701 | nimrod C2, isoform B [Drosophila melanog | 0.446 | 0.174 | 0.355 | 6e-12 |
| >gi|307191598|gb|EFN75095.1| Putative EGF-like domain-containing protein FLJ14712 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Score = 87.4 bits (215), Expect = 6e-15, Method: Compositional matrix adjust.
Identities = 66/182 (36%), Positives = 84/182 (46%), Gaps = 36/182 (19%)
Query: 27 QAVICRFDLKF-VNASYCAPVCSSPCINGACVFPEQCHCSPGFQFVNET--YCEPYCE-N 82
+ C + K VNAS C PVCS PC G CV PE C C+ G+ V ++ CEP C+ N
Sbjct: 901 EVCTCNYGYKATVNASVCEPVCSEPCNMGICVAPETCSCNDGYGLVADSNYICEPICQFN 960
Query: 83 CQHGTCTAPSVCECESGFVHNNETNA-CERICEEPKPP-----------LYPGLGTIPNT 130
C HGTCTAP VC C+ GFV++N T C+ CE P P + G IP+
Sbjct: 961 CNHGTCTAPGVCTCDQGFVYDNSTETICKPRCEIPCGPNGECTSPNNCTCFKGYRAIPSN 1020
Query: 131 ERTCLDNKCHCSEGDSNPYCIIQCDVGYTLNPRTLYCEPECFNCTRGYCLEPNECSCPYN 190
+ DN S D P C C+ F C G C PN C+C
Sbjct: 1021 ASSTSDN----STADFRPICQPVCE----------------FECINGECTAPNVCTCTKG 1060
Query: 191 FH 192
++
Sbjct: 1061 YY 1062
|
Source: Harpegnathos saltator Species: Harpegnathos saltator Genus: Harpegnathos Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270009253|gb|EFA05701.1| nimrod-like protein [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|158298665|ref|XP_318851.4| AGAP009763-PA [Anopheles gambiae str. PEST] gi|157013994|gb|EAA14477.4| AGAP009763-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|322778999|gb|EFZ09403.1| hypothetical protein SINV_02780 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|195579142|ref|XP_002079421.1| GD23945 [Drosophila simulans] gi|194191430|gb|EDX05006.1| GD23945 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|195338359|ref|XP_002035792.1| GM15452 [Drosophila sechellia] gi|194129672|gb|EDW51715.1| GM15452 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195397752|ref|XP_002057492.1| GJ18075 [Drosophila virilis] gi|194141146|gb|EDW57565.1| GJ18075 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|357613215|gb|EHJ68383.1| hypothetical protein KGM_14926 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|195473957|ref|XP_002089258.1| GE19018 [Drosophila yakuba] gi|194175359|gb|EDW88970.1| GE19018 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|28574164|ref|NP_788047.1| nimrod C2, isoform B [Drosophila melanogaster] gi|28380358|gb|AAO41187.1| nimrod C2, isoform B [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 273 | ||||||
| FB|FBgn0243514 | 1054 | eater "eater" [Drosophila mela | 0.534 | 0.138 | 0.343 | 7.8e-22 | |
| FB|FBgn0259896 | 620 | nimC1 "nimrod C1" [Drosophila | 0.483 | 0.212 | 0.360 | 9.5e-21 | |
| FB|FBgn0028543 | 421 | nimB2 "nimrod B2" [Drosophila | 0.622 | 0.403 | 0.327 | 2.2e-19 | |
| FB|FBgn0028939 | 701 | nimC2 "nimrod C2" [Drosophila | 0.523 | 0.203 | 0.327 | 3.1e-19 | |
| FB|FBgn0027929 | 402 | nimB1 "nimrod B1" [Drosophila | 0.622 | 0.422 | 0.317 | 1.4e-17 | |
| UNIPROTKB|F1PLM0 | 1780 | VWDE "Uncharacterized protein" | 0.549 | 0.084 | 0.343 | 1.3e-14 | |
| FB|FBgn0028936 | 315 | nimB5 "nimrod B5" [Drosophila | 0.663 | 0.574 | 0.281 | 6.5e-14 | |
| UNIPROTKB|F1NPY0 | 828 | VWDE "Uncharacterized protein" | 0.542 | 0.178 | 0.345 | 1.5e-13 | |
| UNIPROTKB|Q8N2E2 | 1590 | VWDE "von Willebrand factor D | 0.534 | 0.091 | 0.337 | 3.5e-13 | |
| ZFIN|ZDB-GENE-050208-577 | 1983 | si:ch211-246m6.5 "si:ch211-246 | 0.560 | 0.077 | 0.327 | 1.5e-12 |
| FB|FBgn0243514 eater "eater" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 267 (99.0 bits), Expect = 7.8e-22, P = 7.8e-22
Identities = 58/169 (34%), Positives = 84/169 (49%)
Query: 43 CAPVCSSPCINGACVFPEQCHCSPGFQFVNETYCEPYCEN-CQHGTCTAPSVCECESGFV 101
C P+CS C NG C PE+C C+ G++ +E C P C C++G C AP C C+ G+
Sbjct: 426 CKPICSKGCENGFCDAPEKCSCNDGYEMDSENRCSPVCSGGCKNGFCVAPGKCSCDEGY- 484
Query: 102 HNNET-NACERICEEPKPPLYPGLGTIPNTERTCLD-------NKCH--CSEGDSNPYCI 151
+ ET N+C+ IC + G P + +C D N+C CS G N +C+
Sbjct: 485 -SKETGNSCKPICSKG---CENGFCDAPE-KCSCNDGYEMDGENRCSPVCSGGCKNGFCV 539
Query: 152 I----QCDVGYTLNPRTLYCEPECFN-CTRGYCLEPNECSCPYNFHLEG 195
CD GY+ C+P C N C G+C P +CSC + ++G
Sbjct: 540 APEKCSCDEGYSKETGNS-CKPICSNGCENGFCDAPEKCSCNDGYEMDG 587
|
|
| FB|FBgn0259896 nimC1 "nimrod C1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0028543 nimB2 "nimrod B2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0028939 nimC2 "nimrod C2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0027929 nimB1 "nimrod B1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PLM0 VWDE "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0028936 nimB5 "nimrod B5" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NPY0 VWDE "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8N2E2 VWDE "von Willebrand factor D and EGF domain-containing protein" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-577 si:ch211-246m6.5 "si:ch211-246m6.5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| KOG1225|consensus | 525 | 99.19 | ||
| KOG1225|consensus | 525 | 98.76 | ||
| KOG1214|consensus | 1289 | 98.05 | ||
| KOG1214|consensus | 1289 | 97.67 | ||
| KOG1226|consensus | 783 | 97.63 | ||
| KOG4289|consensus | 2531 | 97.54 | ||
| KOG4260|consensus | 350 | 97.53 | ||
| KOG1226|consensus | 783 | 97.44 | ||
| KOG1219|consensus | 4289 | 97.36 | ||
| KOG1217|consensus | 487 | 97.16 | ||
| KOG4289|consensus | 2531 | 96.94 | ||
| KOG1219|consensus | 4289 | 96.7 | ||
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 96.16 | |
| KOG1217|consensus | 487 | 96.14 | ||
| KOG0994|consensus | 1758 | 96.02 | ||
| smart00051 | 63 | DSL delta serrate ligand. | 95.6 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 94.95 | |
| PF07974 | 32 | EGF_2: EGF-like domain; InterPro: IPR013111 A sequ | 94.69 | |
| smart00051 | 63 | DSL delta serrate ligand. | 94.54 | |
| KOG0994|consensus | 1758 | 93.8 | ||
| PF12661 | 13 | hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E | 93.67 | |
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 93.57 | |
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 92.97 | |
| KOG4260|consensus | 350 | 91.44 | ||
| PF00008 | 32 | EGF: EGF-like domain This is a sub-family of the P | 90.89 | |
| KOG1218|consensus | 316 | 90.82 | ||
| PF12947 | 36 | EGF_3: EGF domain; InterPro: IPR024731 This entry | 90.36 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 90.05 | |
| PF14670 | 36 | FXa_inhibition: Coagulation Factor Xa inhibitory s | 89.62 | |
| PF12662 | 24 | cEGF: Complement Clr-like EGF-like | 88.58 | |
| PF01414 | 63 | DSL: Delta serrate ligand; InterPro: IPR001774 Lig | 87.37 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 86.34 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 85.96 | |
| smart00179 | 39 | EGF_CA Calcium-binding EGF-like domain. | 85.93 | |
| PF07645 | 42 | EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 | 85.55 | |
| PF06247 | 197 | Plasmod_Pvs28: Plasmodium ookinete surface protein | 84.19 | |
| KOG1836|consensus | 1705 | 83.45 | ||
| cd00053 | 36 | EGF Epidermal growth factor domain, found in epide | 83.15 | |
| KOG1218|consensus | 316 | 80.76 |
| >KOG1225|consensus | Back alignment and domain information |
|---|
Probab=99.19 E-value=9.7e-11 Score=114.02 Aligned_cols=126 Identities=27% Similarity=0.601 Sum_probs=84.3
Q ss_pred CceeeeCCCCeeCCCCCCCCCCCCCCC-CCEEcCCCeEEcCCCCeeCCCCCcc-cCC-CCCC-CceecCCCceeeCCCcc
Q psy8491 26 RQAVICRFDLKFVNASYCAPVCSSPCI-NGACVFPEQCHCSPGFQFVNETYCE-PYC-ENCQ-HGTCTAPSVCECESGFV 101 (273)
Q Consensus 26 ~~~C~C~~Gy~~~~~~~C~~~C~~~C~-~g~C~~~~~C~C~~Gy~g~~~~~C~-~~C-~~C~-~G~C~~~~~C~C~~Gy~ 101 (273)
.++|.|..+|.+.+.. ...|++.|. +|.|+. +.|+|++||+| ..|. ..| ..|. |+.++. ++|+|++||+
T Consensus 233 ~~ic~c~~~~~g~~c~--~~~C~~~c~~~g~c~~-G~CIC~~Gf~G---~dC~e~~Cp~~cs~~g~~~~-g~CiC~~g~~ 305 (525)
T KOG1225|consen 233 DGICECPEGYFGPLCS--TIYCPGGCTGRGQCVE-GRCICPPGFTG---DDCDELVCPVDCSGGGVCVD-GECICNPGYS 305 (525)
T ss_pred CceeecCCceeCCccc--cccCCCCCcccceEeC-CeEeCCCCCcC---CCCCcccCCcccCCCceecC-CEeecCCCcc
Confidence 3489999999987654 356777777 788886 89999999999 4554 345 3365 455555 5999999999
Q ss_pred cCCCCCcc-ccccCCCCCCCCCCeecCCCCceeeCCCCCcCCCCCCCCcccccCCCCeeeCCCCCCCCCCCCCCCC-Cee
Q psy8491 102 HNNETNAC-ERICEEPKPPLYPGLGTIPNTERTCLDNKCHCSEGDSNPYCIIQCDVGYTLNPRTLYCEPECFNCTR-GYC 179 (273)
Q Consensus 102 g~~~~~~C-~~~C~~~C~~~~~g~C~~~~~~C~C~~G~C~C~~~C~ng~C~~~C~~Gy~g~~c~~~C~~~C~~C~n-G~C 179 (273)
|. .| ++.|...|.. +|.|+ .++ |. |.+||+|..|..+ + |.+ |.|
T Consensus 306 G~----dCs~~~cpadC~g--~G~Ci-~G~-C~--------------------C~~Gy~G~~C~~~--~----C~~~g~c 351 (525)
T KOG1225|consen 306 GK----DCSIRRCPADCSG--HGKCI-DGE-CL--------------------CDEGYTGELCIQR--A----CSGGGQC 351 (525)
T ss_pred cc----ccccccCCccCCC--CCccc-CCc-eE--------------------eCCCCcCCccccc--c----cCCCcee
Confidence 95 45 2456667766 78877 344 54 5556666655533 1 334 333
Q ss_pred cCCCeeECCCCceeC
Q psy8491 180 LEPNECSCPYNFHLE 194 (273)
Q Consensus 180 ~~~~~C~C~~Gy~G~ 194 (273)
+ .+ |+|..||.|.
T Consensus 352 v-~g-C~C~~Gw~G~ 364 (525)
T KOG1225|consen 352 V-NG-CKCKKGWRGP 364 (525)
T ss_pred c-cC-ceeccCccCC
Confidence 3 34 6677776663
|
|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1214|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >KOG1226|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG4289|consensus | Back alignment and domain information |
|---|
| >KOG1219|consensus | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1217|consensus | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >smart00051 DSL delta serrate ligand | Back alignment and domain information |
|---|
| >KOG0994|consensus | Back alignment and domain information |
|---|
| >PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG4260|consensus | Back alignment and domain information |
|---|
| >PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
| >PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A | Back alignment and domain information |
|---|
| >PF12662 cEGF: Complement Clr-like EGF-like | Back alignment and domain information |
|---|
| >PF01414 DSL: Delta serrate ligand; InterPro: IPR001774 Ligands of the Delta/Serrate/lag-2 (DSL) family and their receptors, members of the lin-12/Notch family, mediate cell-cell interactions that specify cell fate in invertebrates and vertebrates | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >smart00179 EGF_CA Calcium-binding EGF-like domain | Back alignment and domain information |
|---|
| >PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins | Back alignment and domain information |
|---|
| >PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium | Back alignment and domain information |
|---|
| >KOG1836|consensus | Back alignment and domain information |
|---|
| >cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium | Back alignment and domain information |
|---|
| >KOG1218|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 273 | ||||
| 2ygq_A | 324 | Wif Domain-Epidermal Growth Factor (Egf)-Like Domai | 9e-05 |
| >pdb|2YGQ|A Chain A, Wif Domain-Epidermal Growth Factor (Egf)-Like Domains 1-3 Of Human Wnt Inhibitory Factor 1 In Complex With 1,2-Dipalmitoylphosphatidylcholine Length = 324 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 273 | |||
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 1e-07 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 1e-06 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 7e-05 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 2e-05 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 7e-04 |
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 | Back alignment and structure |
|---|
Score = 51.1 bits (122), Expect = 1e-07
Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 8/70 (11%)
Query: 45 PVCSSPCINGACVFPEQCHCSPGF--QFVNETYCEPYCENCQHGTCTAPSVCECESGFVH 102
CS C NG C +C CSPG+ F CEP C + G C P+ C C+ G++
Sbjct: 393 SECSRLCRNGYCTPTGKCCCSPGWEGDFCRTAKCEPACRH--GGVCVRPNKCLCKKGYLG 450
Query: 103 NNETNACERI 112
CE++
Sbjct: 451 PQ----CEQV 456
|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Length = 324 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Length = 169 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.71 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.61 | |
| 2ygq_A | 324 | WIF-1, WNT inhibitory factor 1; signaling protein, | 99.55 | |
| 2vj2_A | 169 | Jagged-1; signalling, polymorphism, glycoprotein, | 99.22 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.18 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 99.13 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 99.05 | |
| 2gy5_A | 423 | Angiopoietin-1 receptor; ligand-binding domain, tr | 99.03 | |
| 1z1y_A | 186 | Ookinete surface protein PVS25; four EGF-like doma | 98.95 | |
| 3fcs_B | 690 | Integrin beta-3; beta propeller, rossmann fold, EG | 98.92 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.8 | |
| 3k6s_B | 687 | Integrin beta-2; cell receptor, adhesion molecule, | 98.76 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 98.69 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.59 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 98.56 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.56 | |
| 2vj3_A | 135 | Neurogenic locus notch homolog protein 1; transcri | 98.48 | |
| 4d90_A | 143 | EGF-like repeat and discoidin I-like domain-conta | 98.48 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 98.34 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 98.3 | |
| 2bou_A | 143 | EGF-like module containing mucin-like hormone rece | 98.22 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 98.21 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 98.19 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 98.0 | |
| 2wg3_C | 463 | Hedgehog-interacting protein; lipoprotein, develop | 97.94 | |
| 1uzk_A | 162 | Fibrillin-1; glycoprotein, extra-cellular matrix, | 97.9 | |
| 2p28_B | 217 | Integrin beta-2; hybrid domain, PSI domain, I-EGF | 97.87 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.87 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 97.83 | |
| 1tpg_A | 91 | T-plasminogen activator F1-G; plasminogen activati | 97.8 | |
| 1emn_A | 82 | Fibrillin; extracellular matrix, calcium-binding, | 97.76 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 97.75 | |
| 4fbr_A | 267 | Lectin, myxobacterial hemagglutinin; beta-barrel, | 97.73 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.71 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 97.69 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 97.69 | |
| 1dx5_I | 118 | Thrombomodulin; serine proteinase, EGF-like domain | 97.63 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.54 | |
| 1yo8_A | 634 | Thrombospondin-2; EGF, Ca(2+)-binding domains, lec | 97.46 | |
| 2w86_A | 147 | Fibrillin-1, fibrillin1; phosphoprotein, EGF-like | 97.44 | |
| 1lmj_A | 86 | Fibrillin 1; EGF, calcium, microfibril, neonatal, | 97.36 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 97.23 | |
| 1klo_A | 162 | Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: | 97.14 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 97.08 | |
| 1aut_L | 114 | Activated protein C; serine proteinase, plasma cal | 97.02 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 96.58 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 96.57 | |
| 1x7a_L | 146 | Coagulation factor IX, light chain; inhibition, bl | 96.55 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 96.46 | |
| 4aqs_A | 525 | Laminin subunit beta-1; cell adhesion; HET: NAG BM | 96.37 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 96.36 | |
| 1z6c_A | 87 | Vitamin K-dependent protein S; EGF module, blood c | 96.36 | |
| 2w2n_E | 107 | LDL receptor, low-density lipoprotein receptor; hy | 96.32 | |
| 1nfu_B | 195 | Coagulation factor XA, light chain; hydrolase; HET | 96.24 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 96.23 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 96.05 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 96.03 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 96.01 | |
| 3h5c_B | 317 | Vitamin K-dependent protein Z; protein Z-protein Z | 95.98 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 95.91 | |
| 2ygo_A | 188 | WIF-1, WNT inhibitory factor 1; signaling protein, | 95.88 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 95.86 | |
| 2vh0_B | 134 | Activated factor XA light chain; serine protease, | 95.86 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 95.83 | |
| 2c4f_L | 142 | Coagulation factor VII precursor; blood coagulatio | 95.75 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 95.55 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 95.34 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 95.19 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 94.99 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 94.88 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 94.27 | |
| 3p5b_L | 400 | Low density lipoprotein receptor variant; B-propel | 94.13 | |
| 3ca7_A | 52 | Protein spitz; argos, EGF, developmental protein, | 94.07 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 93.69 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 93.64 | |
| 3ltf_D | 58 | Protein spitz; receptor-ligand complex ectodomain | 93.61 | |
| 1k36_A | 46 | Epiregulin; EGF-like fold, hormone/growth factor c | 93.47 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 93.07 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 93.06 | |
| 3u7u_G | 55 | Neuregulin 1; signaling protein, transferase-trans | 92.73 | |
| 1edm_B | 39 | Factor IX; epidermal growth factor, EGF, calcium- | 92.57 | |
| 1a3p_A | 45 | Epidermal growth factor; disulfide connectivities, | 92.52 | |
| 1apq_A | 53 | Complement protease C1R; EGF, calcium binding, ser | 92.0 | |
| 2rnl_A | 50 | Amphiregulin; AR, colorectum cell-derived growth f | 91.66 | |
| 2jkh_L | 55 | Factor X light chain; plasma, calcium, zymogen, se | 91.15 | |
| 3zyj_B | 426 | Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA | 91.13 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 91.12 | |
| 1iox_A | 50 | Betacellulin; EGF-like fold, hormone/growth factor | 90.8 | |
| 1egf_A | 53 | Epidermal growth factor; NMR {Mus musculus} SCOP: | 90.12 | |
| 1nql_B | 53 | Epidermal growth factor; cell surface receptor, ty | 89.89 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 89.86 | |
| 1kig_L | 51 | Factor XA; glycoprotein, serine protease, plasma, | 89.34 | |
| 3v65_B | 386 | Low-density lipoprotein receptor-related protein; | 88.95 | |
| 1hae_A | 63 | Heregulin-alpha; growth factor; NMR {Homo sapiens} | 88.91 | |
| 1xdt_R | 79 | Hbegf, heparin-binding epidermal growth factor; co | 88.67 | |
| 1kli_L | 69 | Factor VIIA; extrinsic coagulation pathway, serine | 88.47 | |
| 2wph_E | 59 | Coagulation factor IXA light chain; serine proteas | 88.01 | |
| 2k2s_B | 61 | Micronemal protein 6; microneme protein complex, c | 85.88 | |
| 2bz6_L | 53 | Blood coagulation factor VIIA; serine protease, en | 85.43 | |
| 2e26_A | 725 | Reelin, reeler protein; signaling protein; HET: NA | 83.19 | |
| 1ob1_C | 99 | Major merozoite surface protein; immune system, im | 83.1 | |
| 3e50_C | 50 | Protransforming growth factor alpha; IDE, TGF-alph | 82.39 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 80.68 |
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.71 E-value=1.6e-17 Score=153.03 Aligned_cols=144 Identities=31% Similarity=0.715 Sum_probs=69.6
Q ss_pred CCCCCCCC-CCEEcCCCeEEcCCCCeeCCCCCcc-cCC-CCCC-CceecCCCceeeCCCcccCCCCCccc-cccCCCCCC
Q psy8491 45 PVCSSPCI-NGACVFPEQCHCSPGFQFVNETYCE-PYC-ENCQ-HGTCTAPSVCECESGFVHNNETNACE-RICEEPKPP 119 (273)
Q Consensus 45 ~~C~~~C~-~g~C~~~~~C~C~~Gy~g~~~~~C~-~~C-~~C~-~G~C~~~~~C~C~~Gy~g~~~~~~C~-~~C~~~C~~ 119 (273)
+.|+.+|. +|.|++.++|+|.+||+| ..|+ +.| ..|. +|+|++++.|+|.+||+|. .|+ +.|..+|.+
T Consensus 149 ~~C~~~C~~~G~C~~~~~C~C~~G~~G---~~C~~~~C~~~C~~~G~C~~~~~C~C~~G~~G~----~C~~~~C~~~C~~ 221 (324)
T 2ygq_A 149 AECPGGCRNGGFCNERRICECPDGFHG---PHCEKALCTPRCMNGGLCVTPGFCICPPGFYGV----NCDKANCSTTCFN 221 (324)
T ss_dssp CCCSSCCCSSCEECTTSCEECCTTEES---SSSCEESSSSCCCTTCEECSSCCEECCTTCBTT----TTCBCCCSSCCCS
T ss_pred CCCCCCCCCCCEECCCCeEECCCCCcC---CCCCCCCCCCCCCCCCEEcCCCEEeCCCCccCC----CcccCcCCCCCCC
Confidence 46777888 799998899999999999 6676 456 6777 5899998999999999995 443 457777876
Q ss_pred CCCCeecCCCCceeeCCC----CC---cCCCCCCC-Ccccc----cCCCCeeeCCCCCCCCCCCC-CCC-CCeecCCCee
Q psy8491 120 LYPGLGTIPNTERTCLDN----KC---HCSEGDSN-PYCII----QCDVGYTLNPRTLYCEPECF-NCT-RGYCLEPNEC 185 (273)
Q Consensus 120 ~~~g~C~~~~~~C~C~~G----~C---~C~~~C~n-g~C~~----~C~~Gy~g~~c~~~C~~~C~-~C~-nG~C~~~~~C 185 (273)
+|.|+.... |.|++| .| .|..+|.| |.|+. .|++||+|..|+. ++|. +|. +|+|+..++|
T Consensus 222 --~G~C~~~~~-C~C~~G~~G~~C~~~~C~~~C~~~g~C~~~~~C~C~~G~~G~~C~~---~~C~~~C~~~g~C~~~~~C 295 (324)
T 2ygq_A 222 --GGTCFYPGK-CICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSK---PVCEPGCGAHGTCHEPNKC 295 (324)
T ss_dssp --SCCBSCSSC-BCCCTTCCTTTTC-------------------------------------------------------
T ss_pred --CCeeCCCCe-eeCCCCccCCCCCcCcCCCcCCCCCEECCCCEEECCCCCcCCCCcC---CCCCCCCCCCCEECCCCEe
Confidence 899998777 999999 56 45667776 56665 8999999987762 3444 563 5899988999
Q ss_pred ECCCCceeCCCCccccCC
Q psy8491 186 SCPYNFHLEGGMCMIAEG 203 (273)
Q Consensus 186 ~C~~Gy~G~~~~C~~~~~ 203 (273)
.|++||+| ..|+....
T Consensus 296 ~C~~G~~G--~~C~~~~~ 311 (324)
T 2ygq_A 296 QCQEGWHG--RHCNKRYE 311 (324)
T ss_dssp ------------------
T ss_pred ECCCCCcC--CCCCCCCc
Confidence 99999999 88987643
|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* | Back alignment and structure |
|---|
| >1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A | Back alignment and structure |
|---|
| >3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* | Back alignment and structure |
|---|
| >4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A | Back alignment and structure |
|---|
| >1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A | Back alignment and structure |
|---|
| >2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A | Back alignment and structure |
|---|
| >1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* | Back alignment and structure |
|---|
| >2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A | Back alignment and structure |
|---|
| >1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L | Back alignment and structure |
|---|
| >3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} | Back alignment and structure |
|---|
| >1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A | Back alignment and structure |
|---|
| >1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... | Back alignment and structure |
|---|
| >3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A | Back alignment and structure |
|---|
| >1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A | Back alignment and structure |
|---|
| >1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A | Back alignment and structure |
|---|
| >1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 | Back alignment and structure |
|---|
| >1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* | Back alignment and structure |
|---|
| >2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* | Back alignment and structure |
|---|
| >2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A | Back alignment and structure |
|---|
| >2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* | Back alignment and structure |
|---|
| >2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* | Back alignment and structure |
|---|
| >1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A | Back alignment and structure |
|---|
| >3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 97.11 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 97.1 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.91 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 96.81 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 96.79 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 96.65 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 96.52 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 96.48 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 96.07 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 95.85 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 95.78 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 95.61 | |
| d1autl1 | 48 | Activated protein c (autoprothrombin IIa) {Human ( | 95.59 | |
| d2vj3a1 | 42 | Neurogenic locus notch homolog protein 1, Notch1 { | 95.57 | |
| d3bpse1 | 40 | Low density lipoprotein (LDL) receptor, different | 95.55 | |
| d1xkba1 | 39 | Factor X, N-terminal module {Human (Homo sapiens) | 95.48 | |
| d2vj3a2 | 39 | Neurogenic locus notch homolog protein 1, Notch1 { | 95.32 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 95.21 | |
| d2vj3a3 | 35 | Neurogenic locus notch homolog protein 1, Notch1 { | 95.12 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 95.01 | |
| d1edmb_ | 39 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 94.98 | |
| d2c4fl1 | 37 | Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | 94.93 | |
| d1gl4a2 | 40 | EGF-like domain of nidogen-1 {Mouse (Mus musculus) | 94.8 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 94.7 | |
| d1nt0a3 | 45 | Mannose-binding protein associated serine protease | 94.54 | |
| d1g1sa2 | 40 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 94.02 | |
| d1g1ta2 | 39 | E-selectin, EGF-domain {Human (Homo sapiens) [TaxI | 94.0 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 93.88 | |
| d1tpga1 | 41 | Plasminogen activator (tissue-type), t-PA {Human ( | 93.72 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.71 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 93.7 | |
| d1apqa_ | 53 | Complement protease C1R {Human (Homo sapiens) [Tax | 93.44 | |
| d1autl2 | 50 | Activated protein c (autoprothrombin IIa) {Human ( | 93.21 | |
| d1szba2 | 45 | Mannose-binding protein associated serine protease | 92.78 | |
| d1dx5i3 | 40 | Thrombomodulin, different EGF-like domains {Human | 92.78 | |
| d1nzia2 | 42 | Complement C1S component {Human (Homo sapiens) [Ta | 92.57 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.49 | |
| d2i9aa1 | 40 | Plasminogen activator (urokinase-type) {Human (Hom | 92.48 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.4 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 92.32 | |
| d1emoa1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.25 | |
| d1lmja1 | 44 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 92.07 | |
| d1lmja2 | 42 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 91.81 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 91.74 | |
| d2p3ua1 | 51 | Factor X, N-terminal module {Human (Homo sapiens) | 91.6 | |
| d1xdtr_ | 41 | Heparin-binding epidermal growth factor, HBEGF {Hu | 91.59 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 91.47 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 89.67 | |
| d3egfa_ | 53 | Epidermal growth factor, EGF {Mouse (Mus musculus) | 89.12 | |
| d1q4ga2 | 42 | Prostaglandin H2 synthase-1, EGF-like module {Shee | 88.89 | |
| d1ioxa_ | 50 | Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] | 88.89 | |
| d1uzka2 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 88.89 | |
| d1kigl_ | 51 | Factor X, N-terminal module {Cow (Bos taurus) [Tax | 88.74 | |
| d1moxc_ | 49 | Transforming growth factor alpha {Human (Homo sapi | 88.48 | |
| d1cvua2 | 41 | Prostaglandin H2 synthase-1, EGF-like module {Mous | 87.67 | |
| d1rfnb_ | 57 | Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 | 85.53 | |
| d1haea_ | 63 | Heregulin-alpha, EGF-like domain {Human (Homo sapi | 85.5 | |
| d1i0ua2 | 41 | Low density lipoprotein (LDL) receptor, different | 84.95 | |
| d1ijqa2 | 50 | Low density lipoprotein (LDL) receptor, different | 84.75 | |
| d1uzka1 | 43 | Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | 84.71 | |
| d1k36a_ | 46 | Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI | 84.13 | |
| d1l3ya_ | 41 | Integrin beta EGF-like domains {Human (Homo sapien | 81.67 | |
| d1nqlb_ | 48 | Epidermal growth factor, EGF {Human (Homo sapiens) | 81.66 | |
| d2bz6l1 | 53 | Coagulation factor VIIa {Human (Homo sapiens) [Tax | 80.36 |
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Knottins (small inhibitors, toxins, lectins) superfamily: EGF/Laminin family: EGF-type module domain: Factor X, N-terminal module species: Human (Homo sapiens) [TaxId: 9606]
Probab=97.11 E-value=0.00017 Score=43.87 Aligned_cols=27 Identities=26% Similarity=0.680 Sum_probs=22.7
Q ss_pred CCCC-CeecC---CCeeECCCCceeCCCCcccc
Q psy8491 173 NCTR-GYCLE---PNECSCPYNFHLEGGMCMIA 201 (273)
Q Consensus 173 ~C~n-G~C~~---~~~C~C~~Gy~G~~~~C~~~ 201 (273)
+|+| |+|+. .|.|.|++||+| .+||..
T Consensus 7 PC~ngg~C~~~~~~y~C~C~~G~~G--~~Cei~ 37 (39)
T d1xkba1 7 PCQNQGKCKDGLGEYTCTCLEGFEG--KNCELF 37 (39)
T ss_dssp CCCSSCEECCCSSSCCEECCTTEET--TTTCEE
T ss_pred CCCCCcEEECCCCCEEEECCCCCCc--CcCeEc
Confidence 7877 79974 489999999999 898864
|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i9aa1 g.3.11.1 (A:10-49) Plasminogen activator (urokinase-type) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rfnb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ijqa2 g.3.11.1 (A:643-692) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bz6l1 g.3.11.1 (L:90-142) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|