Diaphorina citri psyllid: psy8503


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-
MISDSNRSIATLAITTLLKTGSESSVDRLMKQIATFVSEISDEFKIVVVEAIRALCLKFPRKHAVLMNFLSAMLRDEGVFRGGIDVLVRSKLAVSADTGVTMQLTVRSTSGLEYKASIADTIITIIEENPEAKETGLAHLCEFIEDCEHTSLAVRILHLLGKEGPRAKQPSKYIRFIYNRVILENATVRAAAVTAMAQFGALCQMDGDDEVRDRATYYHSILASQNKQLIQDYIIEPLMVSIPSLERALHAYNLHPSPTPFDMSSIPLSTITTSDPTEMADRLRTPSGGVASEPTAQATARVESYYEKLSAALPEIANLPGTLFKSAAPVRRDLRSVFHSYAVSMRRQLDVHSASGVGLEDLEISLSDQMAKVNKPNFLALWEEAETDESMNEMEDTFCLSKMESIQEAVASILLPFPRYC
ccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccEEEEcHHHccccccccccHHHHcccccccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccEEEEEEEEEEccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEEEEEEEEEEEEEEEEEEccccccccEEEEEEEEcccccccccccEEEEEccccccccccccccEEEEEccccccccccEEEEEccccc
*****NRSIATLAITTLLKTGSESSVDRLMKQIATFVSEISDEFKIVVVEAIRALCLKFPRKHAVLMNFLSAMLRDEGVFRGGIDVLVRSKLAVSADTGVTMQLTVRSTSGLEYKASIADTIITIIEENPEAKETGLAHLCEFIEDCEHTSLAVRILHLLGKEGPRAKQPSKYIRFIYNRVILENATVRAAAVTAMAQFGALCQMDGDDEVRDRATYYHSILASQNKQLIQDYIIEPLMVSIPSLERALHAYNLHPSPTPFDMSSI*************************************SYYEKLSAALPEIANLPGTLFKSAAPVRRDLRSVFHSYAVSMRRQLDVHSASGVGLEDLEISLSDQMAKVNKPNFLALWEEAETDESMNEMEDTFCLSKMESIQEAVASILLPFPRYC
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISDSNRSIATLAITTLLKTGSESSVDRLMKQIATFVSEISDEFKIVVVEAIRALCLKFPRKHAVLMNFLSAMLRDEGVFRGGIDVLVRSKLAVSADTGVTMQLTVRSTSGLEYKASIADTIITIIEENPEAKETGLAHLCEFIEDCEHTSLAVRILHLLGKEGPRAKQPSKYIRFIYNRVILENATVRAAAVTAMAQFGALCQMDGDDEVRDRATYYHSILASQNKQLIQDYIIEPLMVSIPSLERALHAYNLHPSPTPFDMSSIPLSTITTSDPTEMADRLRTPSGGVASEPTAQATARVESYYEKLSAALPEIANLPGTLFKSAAPVRRDLRSVFHSYAVSMRRQLDVHSASGVGLEDLEISLSDQMAKVNKPNFLALWEEAETDESMNEMEDTFCLSKMESIQEAVASILLPFPRYC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coatomer subunit gamma The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ7PVF6
Coatomer subunit gamma-2 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ9PUE4
Coatomer subunit gamma-2 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors.confidentA2VE21

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006891 [BP]intra-Golgi vesicle-mediated transportprobableGO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030126 [CC]COPI vesicle coatprobableGO:0012506, GO:0043229, GO:0030117, GO:0005622, GO:0030135, GO:0043226, GO:0030137, GO:0005737, GO:0005575, GO:0030660, GO:0030663, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0031982, GO:0048475, GO:0005794, GO:0005798, GO:0030659, GO:0012505, GO:0043227, GO:0030120, GO:0031090, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PZD, chain A
Confidence level:very confident
Coverage over the Query: 296-420
View the alignment between query and template
View the model in PyMOL
Template: 1PZD, chain A
Confidence level:very confident
Coverage over the Query: 70-110
View the alignment between query and template
View the model in PyMOL
Template: 1W63, chain A
Confidence level:confident
Coverage over the Query: 2-78,112-224
View the alignment between query and template
View the model in PyMOL