Diaphorina citri psyllid: psy8505


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MFTYHAGTGRYAHLGSQKTVHVLHNSEQPASVFSILESGVPGGPGGPSGAVKNIPVVADSLFDLLMMKMTPVYTSKKQTKVESKGPRFELGDFCVKLGSVSISQNFKAVLVEVRTSKG
cEEEEccccccccccccCEEEEEEccccccEEEEEECcccccccccccccccccEEEEcHHHHHHHHHHcccCECcccCEEEEccccEEEccEEEEEEEEEEcccccEEEEEEEEccc
MFTY***T*RYAHLGSQKTVHVLHNSEQPASVFSILESGVPGGPGGPSGAVKNIPVVADSLFDLLMMKMTPVYTSKKQ**VESKGPRFELGDFCVKLGSVSISQNFKAVLVEVRTS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTYHAGTGRYAHLGSQKTVHVLHNSEQPASVFSILESGVPGGPGGPSGAVKNIPVVADSLFDLLMMKMTPVYTSKKQTKVESKGPRFELGDFCVKLGSVSISQNFKAVLVEVRTSKG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mediator of RNA polymerase II transcription subunit 20 Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Required for activated transcription of the MtnA gene.confidentP91641
Mediator of RNA polymerase II transcription subunit 20 Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.confidentQ7Q6Y4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0003713 [MF]transcription coactivator activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HZM, chain A
Confidence level:confident
Coverage over the Query: 3-117
View the alignment between query and template
View the model in PyMOL