Diaphorina citri psyllid: psy8506


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MSSDQCYCRVMLTESETEYVVRCIKHSFQSHLILQLEVSNTLSDQLLENVTVQLEIPEGYELIKETPIPRLAYNETQSVYIILQYPPSLADSVTSVGAVLKFSVKDCDPTTGQPDSDEGYDDEYMVSRKGL
ccccccCEEEECcccccEEEEEEEEEEEccEEEEEEEEEEccccEEEEEEEEEEEcccccEEEEEECcccccccccEEEEEEEEccccccccEEEEcEEEEEEEEEEcccccccccccccccCEEcccccc
*****CYCRVMLTESETEYVVRCIKHSFQSHLILQLEVSNTLSDQLLENVTVQLEIPEGYELIKETPIPRLAYNETQSVYIILQYPPSLADSVTSVGAVLKFSVKDCDPTTGQPDSDEGYDDEYMVSRKGL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSDQCYCRVMLTESETEYVVRCIKHSFQSHLILQLEVSNTLSDQLLENVTVQLEIPEGYELIKETPIPRLAYNETQSVYIILQYPPSLADSVTSVGAVLKFSVKDCDPTTGQPDSDEGYDDEYMVSRKGL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Coatomer subunit gamma The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins.confidentQ7PVF6
Coatomer subunit gamma-1 The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. In mammals, the coatomer can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins; the complex also influences the Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. Required for limiting lipid storage in lipid droplets. Involved in lipid homeostasis by regulating the presence of perilipin family members PLIN2 and PLIN3 at the lipid droplet surface and promoting the association of adipocyte triglyceride lipase (PNPLA2) with the lipid droplet surface to mediate lipolysis.confidentP53620
Coatomer subunit gamma The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network. Coatomer complex is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Required for limiting lipid storage in lipid droplets. Involved in the expansion of luminal extracellular matrices and apical membrane during tubulogenesis. Required in the tracheal epithelium for luminal protein secretion and diametric tube growth. In salivary glands, required for deposition of O-glycans and luminal extracellular matrix assembly. Required for epidermal morphogenesis and cuticle development.confidentQ29AE5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016192 [BP]vesicle-mediated transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0010883 [BP]regulation of lipid storageprobableGO:0008150, GO:0032879, GO:0065007, GO:0050789
GO:0044765 [BP]single-organism transportprobableGO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0030126 [CC]COPI vesicle coatprobableGO:0012506, GO:0043229, GO:0030117, GO:0005622, GO:0030135, GO:0043226, GO:0030137, GO:0005737, GO:0005575, GO:0030660, GO:0030663, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0044431, GO:0031982, GO:0048475, GO:0005794, GO:0005798, GO:0030659, GO:0012505, GO:0043227, GO:0030120, GO:0031090, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0051649 [BP]establishment of localization in cellprobableGO:0009987, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005801 [CC]cis-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PZD, chain A
Confidence level:very confident
Coverage over the Query: 8-131
View the alignment between query and template
View the model in PyMOL