Diaphorina citri psyllid: psy8513

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
VARIPSAILGSETALCTETAKSLELKCWNCLKSLSGKSLFCQHCSSVQKPDPQNNYYNVFDMKMQYLINNADLSKKFKHLQSQLHPDKFSNKNQEEQAISETYSSYLNKAYSILQNPLKRGLYLLSLQNISIEEDSKGTDQKLLMEILMLNEELDEASSEEDLENLQTSIRATIEELTKKVNN
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcc
*******ILGSETALCTETAKSLELKCWNCLKSLSGKSLFCQHCSSVQKPDPQNNYYNVFDMKMQYLINNADLSKKFKHLQSQLHP***************TYSSYLNKAYSILQNPLKRGLYLLSLQNISI*******DQKLLMEILMLNEELDEASSEEDLENLQTSIRATIEELTK****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VARIPSAILGSETALCTETAKSLELKCWNCLKSLSGKSLFCQHCSSVQKPDPQNNYYNVFDMKMQYLINNADLSKKFKHLQSQLHPDKFSNKNQEEQAISETYSSYLNKAYSILQNPLKRGLYLLSLQNISIEEDSKGTDQKLLMEILMLNEELDEASSxxxxxxxxxxxxxxxxxxxxxVNN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Co-chaperone protein HscB Co-chaperone involved in the maturation of iron-sulfur cluster-containing proteins. Seems to help targeting proteins to be folded toward HscA.confidentB2K9R4
Co-chaperone protein HscB Co-chaperone involved in the maturation of iron-sulfur cluster-containing proteins. Seems to help targeting proteins to be folded toward HscA.confidentB7UGX3
Iron-sulfur cluster co-chaperone protein HscB, mitochondrial Acts as a co-chaperone in iron-sulfur cluster assembly in mitochondria.confidentQ8K3A0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BVO, chain A
Confidence level:very confident
Coverage over the Query: 25-182
View the alignment between query and template
View the model in PyMOL