Diaphorina citri psyllid: psy8516

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-

MSSRRWFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTELQKENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDIHAGN

ccccccccccccHHHHHHHHHHccccccEEEccccccccccEEEEEEcccEEEEEEEEcccCEEcccccccccHHHHHHHHHHHccccccccccEEECcccccccccccccCEcccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHccccccEEEEcccccccccEEEEEcccccEEEEEEEcccccccccccHHHHHHHHHHHHccccccccccEEEEEcccccccccccccHHHHHHHHHHccccccccHHHHHHHHHcccccccccHccccccccccccccccccccccEEEECccccccccccEEEccccccccccccEEEEcccccccccccccEEEEccEEEEEEEcccccccccccccccccccccEEECcEEEEEEEEEEcccEEEEEEEEEccccccEEEEEEEEccccccccccccHHHHHHHHHHHHcccccccc

****RWFHPSISGVEAEVLLLERGYDGSFLVRPSR*NPGDFTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLIL*KGKNGSFLVRESQS**AEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTE*********GFWEEFESLQQQESRHLF*R*******NRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNT********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tyrosine-protein phosphatase non-receptor type 11	Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to participate in the signal transduction from the cell surface to the nucleus. Dephosphorylates ROCK2 at Tyr-722 resulting in stimulatation of its RhoA binding activity.	confident	P35235
Tyrosine-protein phosphatase non-receptor type 11	Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to participate in the signal transduction from the cell surface to the nucleus. Dephosphorylates ROCK2 at Tyr-722 resulting in stimulatation of its RhoA binding activity.	confident	Q06124
Tyrosine-protein phosphatase non-receptor type 11	Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to participate in the signal transduction from the cell surface to the nucleus. Dephosphorylates ROCK2 at Tyr-722 resulting in stimulatation of its RhoA binding activity.	confident	P41499

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0007165 [BP]	signal transduction	confident	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0005737 [CC]	cytoplasm	confident	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043231 [CC]	intracellular membrane-bounded organelle	confident	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004721 [MF]	phosphoprotein phosphatase activity	confident	GO:0016787, GO:0016791, GO:0016788, GO:0042578, GO:0003824, GO:0003674
GO:0048806 [BP]	genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005001 [MF]	transmembrane receptor protein tyrosine phosphatase activity	probable	GO:0016787, GO:0038023, GO:0016788, GO:0004725, GO:0004721, GO:0042578, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0016791, GO:0019198, GO:0003824
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0017124 [MF]	SH3 domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0018108 [BP]	peptidyl-tyrosine phosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035335 [BP]	peptidyl-tyrosine dephosphorylation	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0042169 [MF]	SH2 domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0043274 [MF]	phospholipase binding	probable	GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0014068 [BP]	positive regulation of phosphatidylinositol 3-kinase cascade	probable	GO:0010646, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0014066, GO:0050789, GO:0048522
GO:0070372 [BP]	regulation of ERK1 and ERK2 cascade	probable	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789, GO:0043408
GO:0036302 [BP]	atrioventricular canal development	probable	GO:0032502, GO:0007507, GO:0032501, GO:0044707, GO:0072358, GO:0048856, GO:0044767, GO:0072359, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0060325 [BP]	face morphogenesis	probable	GO:0032502, GO:0048856, GO:0044767, GO:0060323, GO:0060322, GO:0008150, GO:0060324, GO:0010171, GO:0009653, GO:0044699
GO:0005070 [MF]	SH3/SH2 adaptor activity	probable	GO:0030674, GO:0035591, GO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0019901 [MF]	protein kinase binding	probable	GO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0048013 [BP]	ephrin receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0007420 [BP]	brain development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0042105 [CC]	alpha-beta T cell receptor complex	probable	GO:0043234, GO:0043235, GO:0032991, GO:0042101, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:2001275 [BP]	positive regulation of glucose import in response to insulin stimulus	probable	GO:0048584, GO:0051050, GO:0051049, GO:0008150, GO:0046326, GO:0048583, GO:0050794, GO:0050789, GO:0010827, GO:2001273, GO:0065007, GO:0046324, GO:1900076, GO:0048518, GO:1900078, GO:0032879, GO:0010828, GO:0048522
GO:0009755 [BP]	hormone-mediated signaling pathway	probable	GO:0071495, GO:0044700, GO:0051716, GO:0009719, GO:0070887, GO:0008150, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0050794, GO:0050789, GO:0032870, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0042221, GO:0007154, GO:0010033, GO:0044699
GO:0048839 [BP]	inner ear development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0007275, GO:0044699
GO:2000045 [BP]	regulation of G1/S transition of mitotic cell cycle	probable	GO:0007346, GO:0051726, GO:0010564, GO:0050794, GO:1901987, GO:0065007, GO:1901990, GO:0008150, GO:0050789
GO:0005911 [CC]	cell-cell junction	probable	GO:0005575, GO:0030054
GO:0007596 [BP]	blood coagulation	probable	GO:0032501, GO:0007599, GO:0044707, GO:0050878, GO:0050896, GO:0009611, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0065007, GO:0065008, GO:0044699
GO:0044430 [CC]	cytoskeletal part	probable	GO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0060548 [BP]	negative regulation of cell death	probable	GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0010941, GO:0050789, GO:0048523
GO:0031252 [CC]	cell leading edge	probable	GO:0005575, GO:0044464, GO:0005623
GO:0046825 [BP]	regulation of protein export from nucleus	probable	GO:0033157, GO:0070201, GO:0032879, GO:0060341, GO:0051049, GO:0032386, GO:0050794, GO:0008150, GO:0046822, GO:0065007, GO:0051223, GO:0050789, GO:0032880
GO:0051128 [BP]	regulation of cellular component organization	probable	GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0043560 [MF]	insulin receptor substrate binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0008286 [BP]	insulin receptor signaling pathway	probable	GO:0042221, GO:0007169, GO:0070887, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0032869, GO:0032868, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:1901698, GO:0071417, GO:0071310, GO:0065007, GO:0071495, GO:0044700, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0010243, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0050896
GO:0046887 [BP]	positive regulation of hormone secretion	probable	GO:0032879, GO:0060341, GO:0051046, GO:0051047, GO:0051049, GO:0051050, GO:0050794, GO:0046883, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010646, GO:0050789, GO:0048522
GO:0042267 [BP]	natural killer cell mediated cytotoxicity	probable	GO:0002376, GO:0045087, GO:0006955, GO:0006952, GO:0002449, GO:0006950, GO:0002228, GO:0001909, GO:0002252, GO:0008150, GO:0001906, GO:0002443, GO:0050896, GO:0044699
GO:0042593 [BP]	glucose homeostasis	probable	GO:0033500, GO:0048878, GO:0042592, GO:0008150, GO:0065007, GO:0065008
GO:0050900 [BP]	leukocyte migration	probable	GO:0040011, GO:0048870, GO:0009987, GO:0006928, GO:0002376, GO:0051674, GO:0008150, GO:0044763, GO:0016477, GO:0051179, GO:0044699
GO:0060333 [BP]	interferon-gamma-mediated signaling pathway	probable	GO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0050789, GO:0044699, GO:0019221, GO:0051716, GO:0071310, GO:0065007, GO:0034097, GO:0045087, GO:0009987, GO:0034341, GO:0006952, GO:0006950, GO:0044763, GO:0006955, GO:0007154, GO:0050794, GO:0010033, GO:0044700, GO:0071345, GO:0050896, GO:0071346, GO:0002376, GO:0008150
GO:0060337 [BP]	type I interferon-mediated signaling pathway	probable	GO:0019221, GO:0023052, GO:0007165, GO:0007166, GO:0042221, GO:0070887, GO:0050789, GO:0044699, GO:0051716, GO:0071357, GO:0071310, GO:0065007, GO:0034097, GO:0045087, GO:0009987, GO:0034340, GO:0050794, GO:0006952, GO:0006950, GO:0044763, GO:0006955, GO:0007154, GO:0010033, GO:0044700, GO:0071345, GO:0050896, GO:0002376, GO:0008150
GO:0060334 [BP]	regulation of interferon-gamma-mediated signaling pathway	probable	GO:0050776, GO:0045088, GO:0001959, GO:0009966, GO:0080134, GO:0048583, GO:0050794, GO:0008150, GO:0060330, GO:0002682, GO:0060759, GO:0023051, GO:0065007, GO:0010646, GO:0050789, GO:0031347
GO:0060338 [BP]	regulation of type I interferon-mediated signaling pathway	probable	GO:0050776, GO:0045088, GO:0001959, GO:0009966, GO:0080134, GO:0048583, GO:0050794, GO:0008150, GO:0002682, GO:0060759, GO:0023051, GO:0065007, GO:0010646, GO:0050789, GO:0031347
GO:0042130 [BP]	negative regulation of T cell proliferation	probable	GO:0050868, GO:0050865, GO:0050866, GO:0050863, GO:0065007, GO:0032944, GO:0032945, GO:0050789, GO:0051249, GO:0070663, GO:0002682, GO:0002683, GO:0048519, GO:0070664, GO:0042127, GO:0008285, GO:0042129, GO:0050794, GO:0008150, GO:0051250, GO:0050670, GO:0050672, GO:0002695, GO:0002694, GO:0048523
GO:0042445 [BP]	hormone metabolic process	probable	GO:0065007, GO:0065008, GO:0008150, GO:0008152, GO:0010817
GO:0031295 [BP]	T cell costimulation	probable	GO:0051249, GO:0051251, GO:0050867, GO:0065007, GO:0050865, GO:0050863, GO:0050794, GO:0002376, GO:0002694, GO:0002684, GO:0002696, GO:0008150, GO:0050870, GO:0048518, GO:0002682, GO:0048522, GO:0050789, GO:0031294
GO:0051463 [BP]	negative regulation of cortisol secretion	probable	GO:0051046, GO:0051048, GO:0051049, GO:2000850, GO:0023051, GO:2000831, GO:2000832, GO:0050789, GO:0032879, GO:0060341, GO:0044057, GO:0010646, GO:0065007, GO:0048519, GO:2000849, GO:0051051, GO:2000846, GO:2000847, GO:0046883, GO:0008150, GO:0051239, GO:0046888, GO:0050794, GO:0051462, GO:0044060, GO:0032368, GO:0032369, GO:0048523
GO:0050732 [BP]	negative regulation of peptidyl-tyrosine phosphorylation	probable	GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0009892, GO:0050789, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0065007, GO:0031399, GO:0048519, GO:0045936, GO:0060255, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0042325, GO:0032269, GO:0042326, GO:0050730, GO:0031400, GO:0001933, GO:0001932, GO:0048523
GO:0007186 [BP]	G-protein coupled receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0043407 [BP]	negative regulation of MAP kinase activity	probable	GO:0033673, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0044092, GO:0048585, GO:0031324, GO:0048583, GO:0023057, GO:0043405, GO:0010648, GO:0023051, GO:0009892, GO:0071901, GO:0071900, GO:0010627, GO:0043086, GO:0043409, GO:0043408, GO:0051248, GO:0010646, GO:0010605, GO:0009968, GO:0009966, GO:0051348, GO:0051246, GO:0050789, GO:0065007, GO:0031399, GO:0048519, GO:0065009, GO:0010741, GO:0006469, GO:0045936, GO:0060255, GO:0031323, GO:0045859, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0042325, GO:0032269, GO:0042326, GO:0050790, GO:0010563, GO:0031400, GO:0051338, GO:0001933, GO:0001932, GO:0048523
GO:0001784 [MF]	phosphotyrosine binding	probable	GO:0003674, GO:0051219, GO:0005488, GO:0005515, GO:0045309
GO:0048609 [BP]	multicellular organismal reproductive process	probable	GO:0022414, GO:0032501, GO:0008150, GO:0000003, GO:0032504
GO:0060125 [BP]	negative regulation of growth hormone secretion	probable	GO:0090087, GO:0051046, GO:0051048, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048519, GO:0051051, GO:0050794, GO:0060123, GO:0090276, GO:0046883, GO:0008150, GO:0046888, GO:0032879, GO:0090278, GO:0002791, GO:0002792, GO:0048523
GO:0030334 [BP]	regulation of cell migration	probable	GO:0051270, GO:0050794, GO:0008150, GO:0040012, GO:2000145, GO:0065007, GO:0032879, GO:0050789
GO:0050860 [BP]	negative regulation of T cell receptor signaling pathway	probable	GO:0050854, GO:0050856, GO:0009968, GO:0050858, GO:0048585, GO:0023051, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0002682, GO:0002683, GO:0009966, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0010648
GO:0033628 [BP]	regulation of cell adhesion mediated by integrin	probable	GO:0008150, GO:0030155, GO:0065007, GO:0050789, GO:0050794
GO:0051428 [MF]	peptide hormone receptor binding	probable	GO:0051427, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005158 [MF]	insulin receptor binding	probable	GO:0032403, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0007173 [BP]	epidermal growth factor receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699, GO:0038127
GO:0060397 [BP]	JAK-STAT cascade involved in growth hormone signaling pathway	probable	GO:0042221, GO:0070887, GO:0050896, GO:0023052, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0035556, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0071375, GO:0071378, GO:1901698, GO:0071417, GO:0007259, GO:0071310, GO:0065007, GO:0071495, GO:1901701, GO:0009987, GO:0050794, GO:0032870, GO:0044763, GO:0010243, GO:0007154, GO:0043434, GO:0010033, GO:1901700, GO:0044700, GO:0007243, GO:0009725, GO:0060396, GO:1901699, GO:1901652, GO:1901653, GO:0008150, GO:0060416
GO:0035265 [BP]	organ growth	probable	GO:0044699, GO:0032501, GO:0008150, GO:0040007, GO:0044707
GO:0030971 [MF]	receptor tyrosine kinase binding	probable	GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0046703 [MF]	natural killer cell lectin-like receptor binding	probable	GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0048011 [BP]	neurotrophin TRK receptor signaling pathway	probable	GO:0007166, GO:0007167, GO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0007169, GO:0050789, GO:0044699, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0038179, GO:0009987, GO:0050794, GO:0008150, GO:0042221, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0044763
GO:0046676 [BP]	negative regulation of insulin secretion	probable	GO:0090087, GO:0051046, GO:0051048, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048519, GO:0051051, GO:0050796, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0046888, GO:0032879, GO:0090278, GO:0002791, GO:0002792, GO:0048523
GO:0008543 [BP]	fibroblast growth factor receptor signaling pathway	probable	GO:0007166, GO:0007167, GO:0070848, GO:0023052, GO:0007165, GO:0070887, GO:0042221, GO:0007169, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0044344, GO:0071310, GO:0065007, GO:0071495, GO:0009987, GO:0050794, GO:0044763, GO:0007154, GO:0010033, GO:0044700, GO:0071363, GO:0050896, GO:0071774, GO:0008150
GO:0043167 [MF]	ion binding	probable	GO:0003674, GO:0005488
GO:0009986 [CC]	cell surface	probable	GO:0005575, GO:0044464, GO:0005623
GO:0000077 [BP]	DNA damage checkpoint	probable	GO:0051716, GO:0031570, GO:0000075, GO:0008150, GO:0050789, GO:0050896, GO:0009987, GO:0010564, GO:0010948, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0065007, GO:0044763, GO:0044699, GO:0033554, GO:0048519, GO:0048523, GO:0051726, GO:1901988
GO:0003146 [BP]	heart jogging	probable	GO:0032502, GO:0009790, GO:0072359, GO:0072358, GO:0009799, GO:0009653, GO:0007275, GO:0044699, GO:0002009, GO:0007368, GO:0048513, GO:0048729, GO:0060562, GO:0061371, GO:0048598, GO:0009887, GO:0032501, GO:0035239, GO:0007507, GO:0060429, GO:0035050, GO:0009888, GO:0003007, GO:0007389, GO:0008150, GO:0035295, GO:0003143, GO:0044707, GO:0048856, GO:0044767, GO:0009855, GO:0048731
GO:0050853 [BP]	B cell receptor signaling pathway	probable	GO:0048584, GO:0048583, GO:0023052, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0051716, GO:0002764, GO:0002768, GO:0002684, GO:0002682, GO:0048518, GO:0065007, GO:0050851, GO:0002757, GO:0009987, GO:0050794, GO:0050776, GO:0008150, GO:0007154, GO:0044700, GO:0002429, GO:0050896, GO:0050778, GO:0002376, GO:0002253, GO:0044763
GO:0030424 [CC]	axon	probable	GO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0002924 [BP]	negative regulation of humoral immune response mediated by circulating immunoglobulin	probable	GO:0048585, GO:0048583, GO:0002819, GO:0002707, GO:0002706, GO:0002921, GO:0002704, GO:0002703, GO:0050789, GO:0002890, GO:0002682, GO:0002683, GO:0048519, GO:0002822, GO:0002823, GO:0002820, GO:0002889, GO:0002712, GO:0002713, GO:0008150, GO:0002923, GO:0050777, GO:0050776, GO:0065007, GO:0002697, GO:0002920, GO:0002698
GO:0040014 [BP]	regulation of multicellular organism growth	probable	GO:0008150, GO:0040008, GO:0065007, GO:0050789, GO:0051239
GO:0004726 [MF]	non-membrane spanning protein tyrosine phosphatase activity	probable	GO:0016787, GO:0016791, GO:0004725, GO:0016788, GO:0042578, GO:0003824, GO:0003674, GO:0004721
GO:0007411 [BP]	axon guidance	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0000187 [BP]	activation of MAPK activity	probable	GO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0048584, GO:0048583, GO:0032147, GO:0023056, GO:0043406, GO:0043405, GO:0023051, GO:0071902, GO:0010647, GO:0071900, GO:0010627, GO:0050789, GO:0043085, GO:0043408, GO:0010646, GO:0051347, GO:0010604, GO:0009966, GO:0009967, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0010740, GO:0050790, GO:0045937, GO:0060255, GO:0031323, GO:0045859, GO:0080090, GO:0050794, GO:0043410, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0042327, GO:0045860, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0006641 [BP]	triglyceride metabolic process	probable	GO:0044238, GO:0044710, GO:0009987, GO:0006629, GO:0006639, GO:0006638, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0044255, GO:0046486
GO:0007156 [BP]	homophilic cell adhesion	probable	GO:0016337, GO:0009987, GO:0044763, GO:0007155, GO:0008150, GO:0022610, GO:0044699
GO:0045577 [BP]	regulation of B cell differentiation	probable	GO:0051249, GO:0050865, GO:0050864, GO:0050793, GO:0045595, GO:0050794, GO:0008150, GO:0002694, GO:1902105, GO:0065007, GO:0002682, GO:0045619, GO:0051239, GO:2000026, GO:0050789
GO:0005912 [CC]	adherens junction	probable	GO:0005575, GO:0070161, GO:0030054

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.3.-	Phosphoric monoester hydrolases.	probable
3.1.3.48	Protein-tyrosine-phosphatase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2OQ1, chain A
Confidence level:very confident
Coverage over the Query: 1-230
View the alignment between query and template
View the model in PyMOL

Template: 2SHP, chain A
Confidence level:very confident
Coverage over the Query: 2-130,154-447
View the alignment between query and template
View the model in PyMOL