Psyllid ID: psy8516

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-
MSSRRWFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTELQKENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDIHAGN
ccccccccccccHHHHHHHHHHccccccEEEccccccccccEEEEEEcccEEEEEEEEcccEEEcccccccccHHHHHHHHHHHccccccccccEEEEcccccccccccccEEcccccHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHccccccEEEEcccccccccEEEEEcccccEEEEEEEccccccccccHHHHHHHHHHHHHccccccccccEEEEEcccccccccccccHHHHHHHHHHHcccccccHHHHHHHHHccccccccHHHcccccccccccccccccccccEEEEEccccccccccEEEccccccccccccEEEEcccccccccccccEEEEccEEEEEEEcccccccccccccccccccccEEEEcEEEEEEEEEEcccEEEEEEEEEccccccEEEEEEEEccccccccccccHHHHHHHHHHHHcccccccc
ccccccEcccccHHHHHHHHHHHccccEEEEEEcccccccEEEEEEEccEEEEEEEEEccccEEccccccEccHHHHHHHHHHcHHHcEEcccEEccccEEcccccccccccEcccccHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccEEEEEEcccccccEEEEEEEccEEEEEEEEEccccEEccccccEccHHHHHHHHcccccEEEccEEEEEccccccccccHHHHHHHHHHHHccccccccHHHHHHHHccccccccccccccccccccccccccccccccccEEEccccccccccccEEEEEcEEccHcccEEEcEEcccHHHHHHHHHHHHHccccEEEEccccEccccccEccccccEcEEEEEccEEEEEEEEcccccEccEEEEEEcccccEEEEEEccEccccccccccccHHHHHHHHHHHHHHcccccc
mssrrwfhpsisgVEAEVLLLErgydgsflvrpsrsnpgdftlsvrlngevthikiqntgdcydlyggekfATLSELVQFYMENQGQLKKRNQEVIelkyplscadptterwfhgqlsGKEAEQLILQkgkngsflvrESQSKEAEQLILQkgkngsflvresqskpgdfvlsvrtddkVTHVMIRCQaekydvgggeqfDSLTQLIEHykrnpmvetsgtvvhlkqpfnatritvSNIHDRVTELQkensskagfWEEFESLQQQESRHLFTrregqkldnrnknryknilpfdhtrvklkdvdedvpgaeyinanyiqsedggksyiatqgclpstmnDFWSMVWQENVRVIVMTTKEmergknkcakywpddhqsktygavCVNNMYESVTTDYILREFLVskgsesprkIYHYHFqawpdhgvpsdpgcvlNFLYevntrqdihagn
mssrrwfhpsisgVEAEVLLLERGYDGSflvrpsrsnpgdfTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLILQKGKNGSFLVRESQSKEAEQLILqkgkngsflvresqskpgdfvlsvrtddkvtHVMIRCQAekydvgggeQFDSLTQLIEHYKRNPMVETsgtvvhlkqpfnatritvsnIHDRVTELQKENSSKAGFWEEFESLQQQESRHLftrregqkldnrnknryknilpfdhtrvklkdvdedvpGAEYINAnyiqsedggkSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKcakywpddhqsKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDIHAGN
MSSRRWFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTELQKENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDIHAGN
*****WFHPSISGVEAEVLLLERGYDGSFLVRPS**NPGDFTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSG*****LIL*****************************************DFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRV********************************************YKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNT********
*SSRRWFHPSISGVEAEVLLLERGYDGSFLVRPSR*****FTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLI**KGKNGSFLVRESQS**AEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRN**VETSGTVVHLKQPFNATRITVSNIHDRVTE*********GFWEEFESLQQQESRHLF*R*******NRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEV**********
********PSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTELQKENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDIHAGN
****RWFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTELQKENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQD*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSRRWFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTELQKENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDIHAGN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query451 2.2.26 [Sep-21-2011]
P35235 597 Tyrosine-protein phosphat yes N/A 0.937 0.708 0.630 1e-170
Q06124 597 Tyrosine-protein phosphat yes N/A 0.937 0.708 0.630 1e-170
P41499 597 Tyrosine-protein phosphat yes N/A 0.937 0.708 0.630 1e-169
Q90687 593 Tyrosine-protein phosphat yes N/A 0.937 0.713 0.629 1e-168
P29350 595 Tyrosine-protein phosphat no N/A 0.937 0.710 0.523 1e-140
P81718 613 Tyrosine-protein phosphat no N/A 0.946 0.696 0.514 1e-140
P29351 595 Tyrosine-protein phosphat no N/A 0.937 0.710 0.517 1e-140
P29349 845 Tyrosine-protein phosphat yes N/A 0.660 0.352 0.682 1e-122
Q24708 764 Tyrosine-protein phosphat N/A N/A 0.405 0.239 0.631 3e-67
Q8ISC9 555 Tyrosine-protein phosphat N/A N/A 0.268 0.218 0.64 3e-44
>sp|P35235|PTN11_MOUSE Tyrosine-protein phosphatase non-receptor type 11 OS=Mus musculus GN=Ptpn11 PE=1 SV=2 Back     alignment and function desciption
 Score =  597 bits (1539), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 299/474 (63%), Positives = 351/474 (74%), Gaps = 51/474 (10%)

Query: 1   MSSRRWFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTG 60
           M+SRRWFHP+I+GVEAE LLL RG DGSFL RPS+SNPGDFTLSVR NG VTHIKIQNTG
Sbjct: 1   MTSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDFTLSVRRNGAVTHIKIQNTG 60

Query: 61  DCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGK 120
           D YDLYGGEKFATL+ELVQ+YME+ GQLK++N +VIELKYPL+CADPT+ERWFHG LSGK
Sbjct: 61  DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK 120

Query: 121 EAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDD-- 178
           EAE+L+ +KGK+GSFL                       VRESQS PGDFVLSVRT D  
Sbjct: 121 EAEKLLTEKGKHGSFL-----------------------VRESQSHPGDFVLSVRTGDDK 157

Query: 179 --------KVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFN 230
                   KVTHVMIRCQ  KYDVGGGE+FDSLT L+EHYK+NPMVET GTV+ LKQP N
Sbjct: 158 GESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLN 217

Query: 231 ATRITVSNIHDRVTELQK----ENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKN 286
            TRI  + I  RV EL K     +  K GFWEEFE+LQQQE + L++R+EGQ+ +N+NKN
Sbjct: 218 TTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKN 277

Query: 287 RYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSE--------DGGKSYIATQGCLPST 338
           RYKNILPFDHTRV L D D + P ++YINAN I  E           KSYIATQGCL +T
Sbjct: 278 RYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNT 337

Query: 339 MNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYI 398
           +NDFW MV+QEN RVIVMTTKE+ERGK+KC KYWPD++  K YG + V N+ ES   DY 
Sbjct: 338 VNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYT 397

Query: 399 LREFLVSKGSES------PRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQD 446
           LRE  +SK  ++       R ++ YHF+ WPDHGVPSDPG VL+FL EV+ +Q+
Sbjct: 398 LRELKLSKVGQALLQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQE 451
Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to participate in the signal transduction from the cell surface to the nucleus. Dephosphorylates ROCK2 at Tyr-722 resulting in stimulatation of its RhoA binding activity.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8
>sp|Q06124|PTN11_HUMAN Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens GN=PTPN11 PE=1 SV=2 Back     alignment and function description
>sp|P41499|PTN11_RAT Tyrosine-protein phosphatase non-receptor type 11 OS=Rattus norvegicus GN=Ptpn11 PE=1 SV=4 Back     alignment and function description
>sp|Q90687|PTN11_CHICK Tyrosine-protein phosphatase non-receptor type 11 OS=Gallus gallus GN=PTPN11 PE=2 SV=1 Back     alignment and function description
>sp|P29350|PTN6_HUMAN Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens GN=PTPN6 PE=1 SV=1 Back     alignment and function description
>sp|P81718|PTN6_RAT Tyrosine-protein phosphatase non-receptor type 6 OS=Rattus norvegicus GN=Ptpn6 PE=1 SV=1 Back     alignment and function description
>sp|P29351|PTN6_MOUSE Tyrosine-protein phosphatase non-receptor type 6 OS=Mus musculus GN=Ptpn6 PE=1 SV=2 Back     alignment and function description
>sp|P29349|CSW_DROME Tyrosine-protein phosphatase corkscrew OS=Drosophila melanogaster GN=csw PE=1 SV=2 Back     alignment and function description
>sp|Q24708|CSW_DROVI Tyrosine-protein phosphatase corkscrew (Fragment) OS=Drosophila virilis GN=csw PE=3 SV=1 Back     alignment and function description
>sp|Q8ISC9|CSW_DROSI Tyrosine-protein phosphatase corkscrew (Fragment) OS=Drosophila simulans GN=csw PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query451
242020664 622 tyrosine-protein phosphatase corkscrew, 0.924 0.670 0.717 0.0
270015616 644 hypothetical protein TcasGA2_TC012910 [T 0.935 0.655 0.699 0.0
189242242 654 PREDICTED: similar to protein tyrosine p 0.931 0.642 0.694 0.0
332375260 650 unknown [Dendroctonus ponderosae] 0.929 0.644 0.705 0.0
383859792 616 PREDICTED: tyrosine-protein phosphatase 0.937 0.686 0.657 0.0
380028415 614 PREDICTED: tyrosine-protein phosphatase 0.937 0.688 0.657 0.0
328780747 615 PREDICTED: tyrosine-protein phosphatase 0.937 0.687 0.653 0.0
350412076 616 PREDICTED: tyrosine-protein phosphatase 0.937 0.686 0.655 0.0
340727604 616 PREDICTED: tyrosine-protein phosphatase 0.937 0.686 0.655 0.0
307200353 625 Tyrosine-protein phosphatase non-recepto 0.946 0.683 0.636 0.0
>gi|242020664|ref|XP_002430772.1| tyrosine-protein phosphatase corkscrew, putative [Pediculus humanus corporis] gi|212515969|gb|EEB18034.1| tyrosine-protein phosphatase corkscrew, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  679 bits (1753), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/457 (71%), Positives = 379/457 (82%), Gaps = 40/457 (8%)

Query: 6   WFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTGDCYDL 65
           WFHP+ISGVEAE +LLERG+DGSFL RPSR+NPGDFTLSVR NGEVTHIKIQNTGD YDL
Sbjct: 11  WFHPNISGVEAETVLLERGFDGSFLARPSRANPGDFTLSVRRNGEVTHIKIQNTGDFYDL 70

Query: 66  YGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQL 125
           YGGEKFATLSELVQ+Y+ENQGQ++++N +VIELKYPL+CADPT ERWFHG +SGKEAE++
Sbjct: 71  YGGEKFATLSELVQYYVENQGQVREKNGQVIELKYPLNCADPTPERWFHGHISGKEAEKM 130

Query: 126 ILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMI 185
           IL+KGKNGSFL                       VRESQS+PG FVLSVRT+D+VTHV I
Sbjct: 131 ILEKGKNGSFL-----------------------VRESQSEPGHFVLSVRTEDRVTHVKI 167

Query: 186 RCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTE 245
           RCQ  KYDVGGGE+F+SL++LIE+YK+NPMVETSGTVVHLKQPFNATRI  S I  RV E
Sbjct: 168 RCQENKYDVGGGERFESLSELIEYYKKNPMVETSGTVVHLKQPFNATRINASGIDTRVKE 227

Query: 246 LQKENSS---KAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLK 302
           LQKEN +   KAGFWEEFESLQQQE RHLFTR++GQ+ +NRNKNRYKNILPFDHTRVKLK
Sbjct: 228 LQKENGAATGKAGFWEEFESLQQQECRHLFTRKQGQRPENRNKNRYKNILPFDHTRVKLK 287

Query: 303 DVDEDVPGAEYINANYIQ-----------SEDGGKSYIATQGCLPSTMNDFWSMVWQENV 351
           + D ++PG+EYINANYI+           SE G KSYIATQGCLPST+ D W MVWQENV
Sbjct: 288 NADPNIPGSEYINANYIRQEPQEGSGLAGSEVGLKSYIATQGCLPSTVADLWMMVWQENV 347

Query: 352 RVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVS--KGSE 409
           RVIVMTTKE+ERGKNKCA+YWPD +QSK YG + V ++ E+ T+DY LR+FLVS  +G+E
Sbjct: 348 RVIVMTTKEIERGKNKCARYWPDKNQSKEYGPIKVCSVSETSTSDYTLRQFLVSSEEGTE 407

Query: 410 SPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQD 446
             + IYHYHFQAWPDHGVPSDPGCVLNFL++VN RQ+
Sbjct: 408 Q-KTIYHYHFQAWPDHGVPSDPGCVLNFLHDVNARQE 443

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270015616|gb|EFA12064.1| hypothetical protein TcasGA2_TC012910 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189242242|ref|XP_971440.2| PREDICTED: similar to protein tyrosine phosphatase, non-receptor type 11 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332375260|gb|AEE62771.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|383859792|ref|XP_003705376.1| PREDICTED: tyrosine-protein phosphatase corkscrew-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380028415|ref|XP_003697898.1| PREDICTED: tyrosine-protein phosphatase corkscrew-like [Apis florea] Back     alignment and taxonomy information
>gi|328780747|ref|XP_003249854.1| PREDICTED: tyrosine-protein phosphatase corkscrew [Apis mellifera] Back     alignment and taxonomy information
>gi|350412076|ref|XP_003489537.1| PREDICTED: tyrosine-protein phosphatase corkscrew-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340727604|ref|XP_003402130.1| PREDICTED: tyrosine-protein phosphatase corkscrew-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|307200353|gb|EFN80605.1| Tyrosine-protein phosphatase non-receptor type 11 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query451
FB|FBgn0000382 845 csw "corkscrew" [Drosophila me 0.399 0.213 0.720 6.5e-171
UNIPROTKB|F1Q3J6 593 PTPN11 "Uncharacterized protei 0.960 0.730 0.641 1.4e-151
ZFIN|ZDB-GENE-030131-5911 594 ptpn11a "protein tyrosine phos 0.960 0.728 0.635 4.7e-151
MGI|MGI:99511 597 Ptpn11 "protein tyrosine phosp 0.968 0.731 0.631 7.6e-151
UNIPROTKB|Q06124 597 PTPN11 "Tyrosine-protein phosp 0.960 0.725 0.635 9.8e-151
RGD|3447 597 Ptpn11 "protein tyrosine phosp 0.968 0.731 0.631 1.2e-150
UNIPROTKB|Q90687 593 PTPN11 "Tyrosine-protein phosp 0.960 0.730 0.634 4.2e-150
UNIPROTKB|F1N339 597 PTPN11 "Uncharacterized protei 0.957 0.723 0.635 8.8e-150
ZFIN|ZDB-GENE-040426-1158 592 ptpn11b "protein tyrosine phos 0.957 0.729 0.624 1.4e-149
UNIPROTKB|F1NFY8 593 PTPN11 "Tyrosine-protein phosp 0.960 0.730 0.630 6.2e-149
FB|FBgn0000382 csw "corkscrew" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 673 (242.0 bits), Expect = 6.5e-171, Sum P(3) = 6.5e-171
 Identities = 134/186 (72%), Positives = 153/186 (82%)

Query:   143 KEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDS 202
             KEAE+LIL++GKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIR Q +KYDVGGGE F +
Sbjct:   119 KEAEKLILERGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRWQDKKYDVGGGESFGT 178

Query:   203 LTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTELQKENSSKAGFWEEFES 262
             L++LI+HYKRNPMVET GTVVHL+QPFNATRIT + I+ RV +L K      GFWEEFES
Sbjct:   179 LSELIDHYKRNPMVETCGTVVHLRQPFNATRITAAGINARVEQLVK-----GGFWEEFES 233

Query:   263 LQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSE 322
             LQQ +SR  F+R EG K +NR KNRY+NILP+DHTRVKL DV+  V GAEYINANYI+  
Sbjct:   234 LQQ-DSRDTFSRNEGYKQENRLKNRYRNILPYDHTRVKLLDVEHSVAGAEYINANYIRLP 292

Query:   323 DGGKSY 328
               G  Y
Sbjct:   293 TDGDLY 298
GO:0007465 "R7 cell fate commitment" evidence=IGI
GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=IGI;IMP
GO:0007362 "terminal region determination" evidence=IMP
GO:0004726 "non-membrane spanning protein tyrosine phosphatase activity" evidence=ISS;NAS
GO:0008293 "torso signaling pathway" evidence=IGI;NAS;TAS
GO:0006470 "protein dephosphorylation" evidence=NAS;IDA
GO:0004725 "protein tyrosine phosphatase activity" evidence=NAS;IDA
GO:0007418 "ventral midline development" evidence=IMP
GO:0007444 "imaginal disc development" evidence=IMP
GO:0008543 "fibroblast growth factor receptor signaling pathway" evidence=IMP
GO:0007427 "epithelial cell migration, open tracheal system" evidence=IMP
GO:0008069 "dorsal/ventral axis specification, ovarian follicular epithelium" evidence=IMP
GO:0004728 "receptor signaling protein tyrosine phosphatase activity" evidence=NAS
GO:0005515 "protein binding" evidence=IPI
GO:0008595 "anterior/posterior axis specification, embryo" evidence=TAS
GO:0005737 "cytoplasm" evidence=NAS
GO:0045500 "sevenless signaling pathway" evidence=TAS
GO:0007498 "mesoderm development" evidence=IMP
GO:0007428 "primary branching, open tracheal system" evidence=TAS
GO:0007424 "open tracheal system development" evidence=IGI
GO:0045314 "regulation of compound eye photoreceptor development" evidence=IMP
GO:0000278 "mitotic cell cycle" evidence=IMP
UNIPROTKB|F1Q3J6 PTPN11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5911 ptpn11a "protein tyrosine phosphatase, non-receptor type 11, a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:99511 Ptpn11 "protein tyrosine phosphatase, non-receptor type 11" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q06124 PTPN11 "Tyrosine-protein phosphatase non-receptor type 11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|3447 Ptpn11 "protein tyrosine phosphatase, non-receptor type 11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q90687 PTPN11 "Tyrosine-protein phosphatase non-receptor type 11" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N339 PTPN11 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1158 ptpn11b "protein tyrosine phosphatase, non-receptor type 11, b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFY8 PTPN11 "Tyrosine-protein phosphatase non-receptor type 11" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35235PTN11_MOUSE3, ., 1, ., 3, ., 4, 80.63080.93790.7085yesN/A
Q90687PTN11_CHICK3, ., 1, ., 3, ., 4, 80.62970.93790.7133yesN/A
P29349CSW_DROME3, ., 1, ., 3, ., 4, 80.68290.66070.3526yesN/A
P41499PTN11_RAT3, ., 1, ., 3, ., 4, 80.63080.93790.7085yesN/A
Q06124PTN11_HUMAN3, ., 1, ., 3, ., 4, 80.63080.93790.7085yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3LOW CONFIDENCE prediction!
3rd Layer3.1.3.480.914

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query451
cd00047231 cd00047, PTPc, Protein tyrosine phosphatases (PTP) 3e-79
smart00194259 smart00194, PTPc, Protein tyrosine phosphatase, ca 4e-77
pfam00102233 pfam00102, Y_phosphatase, Protein-tyrosine phospha 6e-70
cd0993199 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo 6e-58
cd1034099 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo 7e-58
COG5599302 COG5599, PTP2, Protein tyrosine phosphatase [Signa 1e-34
PHA02738 320 PHA02738, PHA02738, hypothetical protein; Provisio 3e-34
cd0993199 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo 2e-30
pfam0001777 pfam00017, SH2, SH2 domain 6e-30
PHA02742303 PHA02742, PHA02742, protein tyrosine phosphatase; 2e-28
PHA02747312 PHA02747, PHA02747, protein tyrosine phosphatase; 6e-26
smart0025284 smart00252, SH2, Src homology 2 domains 1e-25
pfam0001777 pfam00017, SH2, SH2 domain 2e-25
smart0025284 smart00252, SH2, Src homology 2 domains 2e-24
cd1034099 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo 6e-24
PHA02746323 PHA02746, PHA02746, protein tyrosine phosphatase; 7e-21
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 1e-20
cd0017379 cd00173, SH2, Src homology 2 (SH2) domain 5e-20
cd0993798 cd09937, SH2_csk_like, Src homology 2 (SH2) domain 7e-19
cd1035477 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 3e-17
cd1034199 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src 2e-16
cd0994195 cd09941, SH2_Grb2_like, Src homology 2 domain foun 2e-16
cd09933101 cd09933, SH2_Src_family, Src homology 2 (SH2) doma 4e-16
cd09932104 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src 1e-15
cd1034781 cd10347, SH2_Nterm_shark_like, N-terminal Src homo 2e-15
cd0994393 cd09943, SH2_Nck_family, Src homology 2 (SH2) doma 3e-15
cd0993798 cd09937, SH2_csk_like, Src homology 2 (SH2) domain 4e-15
cd1034781 cd10347, SH2_Nterm_shark_like, N-terminal Src homo 5e-15
cd0993594 cd09935, SH2_ABL, Src homology 2 (SH2) domain foun 1e-14
cd09933101 cd09933, SH2_Src_family, Src homology 2 (SH2) doma 6e-14
cd0993594 cd09935, SH2_ABL, Src homology 2 (SH2) domain foun 1e-13
cd1035291 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 2e-13
cd09944108 cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom 2e-13
cd10337136 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in 4e-13
PHA02740298 PHA02740, PHA02740, protein tyrosine phosphatase; 4e-13
cd1036190 cd10361, SH2_Fps_family, Src homology 2 (SH2) doma 6e-13
cd09932104 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src 1e-12
cd1034199 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src 2e-12
cd0994195 cd09941, SH2_Grb2_like, Src homology 2 domain foun 2e-12
cd1035477 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 3e-12
cd09944108 cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom 3e-12
cd1040897 cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou 3e-12
cd10414108 cd10414, SH2_Grb14, Src homology 2 (SH2) domain fo 5e-12
cd1040998 cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou 7e-12
cd1035592 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma 8e-12
cd10353103 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 8e-12
cd1037096 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domai 8e-12
cd10405103 cd10405, SH2_Vav1, Src homology 2 (SH2) domain fou 1e-11
cd1034886 cd10348, SH2_Cterm_shark_like, C-terminal Src homo 2e-11
cd1035592 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma 3e-11
cd10337136 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in 5e-11
cd09938104 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src 1e-10
cd09929121 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) dom 1e-10
cd09926106 cd09926, SH2_CRK_like, Src homology 2 domain found 2e-10
cd1034697 cd10346, SH2_SH2B_family, Src homology 2 (SH2) dom 2e-10
cd0994393 cd09943, SH2_Nck_family, Src homology 2 (SH2) doma 3e-10
cd09934104 cd09934, SH2_Tec_family, Src homology 2 (SH2) doma 3e-10
cd1040199 cd10401, SH2_C-SH2_Syk_like, C-terminal Src homolo 4e-10
cd1034886 cd10348, SH2_Cterm_shark_like, C-terminal Src homo 6e-10
cd1040897 cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou 1e-09
cd1040998 cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou 1e-09
cd09938104 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src 1e-09
cd09930104 cd09930, SH2_cSH2_p85_like, C-terminal Src homolog 1e-09
cd10343103 cd10343, SH2_SHIP, Src homology 2 (SH2) domain fou 1e-09
cd1036079 cd10360, SH2_Srm, Src homology 2 (SH2) domain foun 1e-09
cd0994598 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 2e-09
cd1036190 cd10361, SH2_Fps_family, Src homology 2 (SH2) doma 3e-09
cd10414108 cd10414, SH2_Grb14, Src homology 2 (SH2) domain fo 3e-09
cd09940102 cd09940, SH2_Vav_family, Src homology 2 (SH2) doma 4e-09
cd10353103 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 5e-09
cd10413108 cd10413, SH2_Grb7, Src homology 2 (SH2) domain fou 6e-09
cd1037096 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domai 1e-08
cd0994598 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 1e-08
cd10415108 cd10415, SH2_Grb10, Src homology 2 (SH2) domain fo 1e-08
cd1036996 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain 1e-08
cd09942110 cd09942, SH2_nSH2_p85_like, N-terminal Src homolog 2e-08
cd10396108 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain 2e-08
cd10351103 cd10351, SH2_SH2D4B, Src homology 2 domain found i 2e-08
cd10362101 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain 3e-08
cd10367101 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain 3e-08
cd09930104 cd09930, SH2_cSH2_p85_like, C-terminal Src homolog 5e-08
cd10415108 cd10415, SH2_Grb10, Src homology 2 (SH2) domain fo 5e-08
cd09925104 cd09925, SH2_SHC, Src homology 2 (SH2) domain foun 5e-08
cd10407103 cd10407, SH2_Vav3, Src homology 2 (SH2) domain fou 5e-08
cd10418101 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 7e-08
cd09942110 cd09942, SH2_nSH2_p85_like, N-terminal Src homolog 9e-08
cd10397106 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain 1e-07
cd10366101 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain 1e-07
cd10388101 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain fo 2e-07
cd10413108 cd10413, SH2_Grb7, Src homology 2 (SH2) domain fou 3e-07
cd1036996 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain 3e-07
cd10356113 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domai 3e-07
cd09934104 cd09934, SH2_Tec_family, Src homology 2 (SH2) doma 4e-07
cd10343103 cd10343, SH2_SHIP, Src homology 2 (SH2) domain fou 4e-07
cd10344104 cd10344, SH2_SLAP, Src homology 2 domain found in 4e-07
cd09940102 cd09940, SH2_Vav_family, Src homology 2 (SH2) doma 5e-07
cd09926106 cd09926, SH2_CRK_like, Src homology 2 domain found 6e-07
cd09925104 cd09925, SH2_SHC, Src homology 2 (SH2) domain foun 6e-07
cd10368101 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain 6e-07
cd10417102 cd10417, SH2_SH2D7, Src homology 2 domain found in 7e-07
cd09929121 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) dom 9e-07
cd10362101 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain 9e-07
cd10350103 cd10350, SH2_SH2D4A, Src homology 2 domain found i 1e-06
cd10371100 cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain 1e-06
cd10344104 cd10344, SH2_SLAP, Src homology 2 domain found in 2e-06
cd10363104 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain 2e-06
cd1034977 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain f 2e-06
cd1041097 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain fo 2e-06
cd1038997 cd10389, SH2_SHB, Src homology 2 domain found in S 2e-06
cd10419101 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2e-06
cd10365101 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain 2e-06
cd1034697 cd10346, SH2_SH2B_family, Src homology 2 (SH2) dom 3e-06
cd1039098 cd10390, SH2_SHD, Src homology 2 domain found in S 3e-06
cd1038298 cd10382, SH2_SOCS1, Src homology 2 (SH2) domain fo 3e-06
cd1035787 cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domai 3e-06
cd10399106 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain 3e-06
cd1039098 cd10390, SH2_SHD, Src homology 2 domain found in S 4e-06
cd10402105 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 4e-06
cd1039298 cd10392, SH2_SHF, Src homology 2 domain found in S 4e-06
cd1036079 cd10360, SH2_Srm, Src homology 2 (SH2) domain foun 5e-06
cd10398106 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain 5e-06
cd10402105 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 6e-06
cd10405103 cd10405, SH2_Vav1, Src homology 2 (SH2) domain fou 7e-06
cd10417102 cd10417, SH2_SH2D7, Src homology 2 domain found in 9e-06
cd10371100 cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain 1e-05
cd1041297 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain fo 1e-05
smart00404105 smart00404, PTPc_motif, Protein tyrosine phosphata 1e-05
smart00012105 smart00012, PTPc_DSPc, Protein tyrosine phosphatas 1e-05
cd1040199 cd10401, SH2_C-SH2_Syk_like, C-terminal Src homolo 3e-05
cd1041197 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain fo 3e-05
cd10406103 cd10406, SH2_Vav2, Src homology 2 (SH2) domain fou 3e-05
cd1039298 cd10392, SH2_SHF, Src homology 2 domain found in S 4e-05
cd1041297 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain fo 4e-05
cd1041197 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain fo 4e-05
cd0992381 cd09923, SH2_SOCS_family, Src homology 2 (SH2) dom 4e-05
cd10364101 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain 4e-05
cd10367101 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain 6e-05
cd1034977 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain f 6e-05
cd09946102 cd09946, SH2_HSH2_like, Src homology 2 domain foun 6e-05
cd10400103 cd10400, SH2_SAP1a, Src homology 2 (SH2) domain fo 6e-05
cd1035291 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 8e-05
cd10363104 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain 8e-05
cd1038997 cd10389, SH2_SHB, Src homology 2 domain found in S 1e-04
cd0992381 cd09923, SH2_SOCS_family, Src homology 2 (SH2) dom 1e-04
cd10384101 cd10384, SH2_SOCS3, Src homology 2 (SH2) domain fo 1e-04
cd1041097 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain fo 2e-04
cd10419101 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2e-04
cd1039198 cd10391, SH2_SHE, Src homology 2 domain found in S 2e-04
cd10388101 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain fo 3e-04
cd10406103 cd10406, SH2_Vav2, Src homology 2 (SH2) domain fou 3e-04
cd10383103 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain fo 3e-04
cd10342103 cd10342, SH2_SAP1, Src homology 2 (SH2) domain fou 4e-04
cd10368101 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain 5e-04
cd1038298 cd10382, SH2_SOCS1, Src homology 2 (SH2) domain fo 5e-04
cd10384101 cd10384, SH2_SOCS3, Src homology 2 (SH2) domain fo 5e-04
cd09927116 cd09927, SH2_Tensin_like, Src homology 2 domain fo 5e-04
cd10342103 cd10342, SH2_SAP1, Src homology 2 (SH2) domain fou 6e-04
cd10407103 cd10407, SH2_Vav3, Src homology 2 (SH2) domain fou 7e-04
cd09946102 cd09946, SH2_HSH2_like, Src homology 2 domain foun 7e-04
cd1071888 cd10718, SH2_CIS, Src homology 2 (SH2) domain foun 7e-04
cd10418101 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 8e-04
cd10358100 cd10358, SH2_PTK6_Brk, Src homology 2 domain found 0.001
cd10358100 cd10358, SH2_PTK6_Brk, Src homology 2 domain found 0.001
cd10387100 cd10387, SH2_SOCS6, Src homology 2 (SH2) domain fo 0.001
cd10396108 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain 0.002
cd10351103 cd10351, SH2_SH2D4B, Src homology 2 domain found i 0.002
cd10397106 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain 0.002
cd10366101 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain 0.002
cd10400103 cd10400, SH2_SAP1a, Src homology 2 (SH2) domain fo 0.002
cd10399106 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain 0.003
cd09927116 cd09927, SH2_Tensin_like, Src homology 2 domain fo 0.004
>gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information 
 Score =  245 bits (627), Expect = 3e-79
 Identities = 79/165 (47%), Positives = 109/165 (66%), Gaps = 3/165 (1%)

Query: 285 KNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWS 344
           KNRYK+ILP+DHTRVKLK  D+   G++YINA+YI   +  K+YIATQG LP+T+ DFW 
Sbjct: 2   KNRYKDILPYDHTRVKLKPDDD--EGSDYINASYIDGYNPPKAYIATQGPLPNTVEDFWR 59

Query: 345 MVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLV 404
           MVW++ V VIVM T+ +E+G+ KCA+YWP++  S TYG + V  + E    DY +R   +
Sbjct: 60  MVWEQKVPVIVMLTELVEKGREKCAQYWPEEEGSLTYGDITVTLVSEEKLDDYTVRTLKL 119

Query: 405 S-KGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDIH 448
           S  G+   R + H+ +  WPDHGVP  P  +L+ L +V   Q   
Sbjct: 120 SNTGTGETRTVTHFQYTGWPDHGVPESPDSLLDLLRKVRKSQQQP 164

The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active. Length = 231
>gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase Back     alignment and domain information
>gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|215658 pfam00017, SH2, SH2 domain Back     alignment and domain information
>gnl|CDD|214585 smart00252, SH2, Src homology 2 domains Back     alignment and domain information
>gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins Back     alignment and domain information
>gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain Back     alignment and domain information
>gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) Back     alignment and domain information
>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins Back     alignment and domain information
>gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases Back     alignment and domain information
>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family Back     alignment and domain information
>gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) Back     alignment and domain information
>gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins Back     alignment and domain information
>gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases Back     alignment and domain information
>gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins Back     alignment and domain information
>gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins Back     alignment and domain information
>gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins Back     alignment and domain information
>gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast Cancer Anti-estrogen Resistance protein 3 Back     alignment and domain information
>gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins Back     alignment and domain information
>gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma Back     alignment and domain information
>gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins Back     alignment and domain information
>gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins Back     alignment and domain information
>gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|198277 cd10414, SH2_Grb14, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 14 (Grb14) proteins Back     alignment and domain information
>gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins Back     alignment and domain information
>gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the Src oncogene at 42A (Src42) Back     alignment and domain information
>gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1 proteins Back     alignment and domain information
>gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins Back     alignment and domain information
>gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast Cancer Anti-estrogen Resistance protein 3 Back     alignment and domain information
>gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins Back     alignment and domain information
>gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in B-cell linker (BLNK) protein and SH2 domain-containing leukocyte protein of 76 kDa (SLP-76) Back     alignment and domain information
>gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK Back     alignment and domain information
>gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in SH2B adapter protein family Back     alignment and domain information
>gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family Back     alignment and domain information
>gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in Tec-like proteins Back     alignment and domain information
>gnl|CDD|198264 cd10401, SH2_C-SH2_Syk_like, C-terminal Src homology 2 (SH2) domain found in Spleen tyrosine kinase (Syk) proteins Back     alignment and domain information
>gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins Back     alignment and domain information
>gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck Back     alignment and domain information
>gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins Back     alignment and domain information
>gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in SH2-containing inositol-5'-phosphatase (SHIP) and SLAM-associated protein (SAP) Back     alignment and domain information
>gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) Back     alignment and domain information
>gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) Back     alignment and domain information
>gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins Back     alignment and domain information
>gnl|CDD|198277 cd10414, SH2_Grb14, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 14 (Grb14) proteins Back     alignment and domain information
>gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family Back     alignment and domain information
>gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) Back     alignment and domain information
>gnl|CDD|198276 cd10413, SH2_Grb7, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins Back     alignment and domain information
>gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the Src oncogene at 42A (Src42) Back     alignment and domain information
>gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) Back     alignment and domain information
>gnl|CDD|198278 cd10415, SH2_Grb10, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 10 (Grb10) proteins Back     alignment and domain information
>gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) Back     alignment and domain information
>gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|198259 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain found in Tec protein, IL2-inducible T-cell kinase (Itk) Back     alignment and domain information
>gnl|CDD|198214 cd10351, SH2_SH2D4B, Src homology 2 domain found in the SH2 domain containing protein 4B (SH2D4B) Back     alignment and domain information
>gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte cell kinase (Lck) Back     alignment and domain information
>gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr Back     alignment and domain information
>gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|198278 cd10415, SH2_Grb10, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 10 (Grb10) proteins Back     alignment and domain information
>gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor protein C (SHC) Back     alignment and domain information
>gnl|CDD|198270 cd10407, SH2_Vav3, Src homology 2 (SH2) domain found in the Vav3 proteins Back     alignment and domain information
>gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain found in Fyn isoform a like proteins Back     alignment and domain information
>gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 Back     alignment and domain information
>gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found in Tec protein, Bruton's tyrosine kinase (Btk) Back     alignment and domain information
>gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes Back     alignment and domain information
>gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198276 cd10413, SH2_Grb7, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins Back     alignment and domain information
>gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) Back     alignment and domain information
>gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases A and C (ShkA and ShkC) Back     alignment and domain information
>gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in Tec-like proteins Back     alignment and domain information
>gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in SH2-containing inositol-5'-phosphatase (SHIP) and SLAM-associated protein (SAP) Back     alignment and domain information
>gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins Back     alignment and domain information
>gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family Back     alignment and domain information
>gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK Back     alignment and domain information
>gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor protein C (SHC) Back     alignment and domain information
>gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn Back     alignment and domain information
>gnl|CDD|199832 cd10417, SH2_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 7 (SH2D7) Back     alignment and domain information
>gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in B-cell linker (BLNK) protein and SH2 domain-containing leukocyte protein of 76 kDa (SLP-76) Back     alignment and domain information
>gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte cell kinase (Lck) Back     alignment and domain information
>gnl|CDD|198213 cd10350, SH2_SH2D4A, Src homology 2 domain found in the SH2 domain containing protein 4A (SH2D4A) Back     alignment and domain information
>gnl|CDD|198234 cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain found in B lymphoid kinase (Blk) Back     alignment and domain information
>gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins Back     alignment and domain information
>gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK Back     alignment and domain information
>gnl|CDD|199830 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 2A and 7 (SH2D2A and SH2D7) Back     alignment and domain information
>gnl|CDD|198273 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) Back     alignment and domain information
>gnl|CDD|198252 cd10389, SH2_SHB, Src homology 2 domain found in SH2 domain-containing adapter protein B (SHB) Back     alignment and domain information
>gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins Back     alignment and domain information
>gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in tyrosine kinase sarcoma (Src) Back     alignment and domain information
>gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in SH2B adapter protein family Back     alignment and domain information
>gnl|CDD|198253 cd10390, SH2_SHD, Src homology 2 domain found in SH2 domain-containing adapter proteins D (SHD) Back     alignment and domain information
>gnl|CDD|198245 cd10382, SH2_SOCS1, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198220 cd10357, SH2_ShkD_ShkE, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases D and E (ShkD and ShkE) Back     alignment and domain information
>gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found in Tec protein, Bmx Back     alignment and domain information
>gnl|CDD|198253 cd10390, SH2_SHD, Src homology 2 domain found in SH2 domain-containing adapter proteins D (SHD) Back     alignment and domain information
>gnl|CDD|198265 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) Back     alignment and domain information
>gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2 domain-containing adapter protein F (SHF) Back     alignment and domain information
>gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) Back     alignment and domain information
>gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found in Tec protein, Txk Back     alignment and domain information
>gnl|CDD|198265 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) Back     alignment and domain information
>gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1 proteins Back     alignment and domain information
>gnl|CDD|199832 cd10417, SH2_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 7 (SH2D7) Back     alignment and domain information
>gnl|CDD|198234 cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain found in B lymphoid kinase (Blk) Back     alignment and domain information
>gnl|CDD|198275 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) Back     alignment and domain information
>gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>gnl|CDD|198264 cd10401, SH2_C-SH2_Syk_like, C-terminal Src homology 2 (SH2) domain found in Spleen tyrosine kinase (Syk) proteins Back     alignment and domain information
>gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) Back     alignment and domain information
>gnl|CDD|198269 cd10406, SH2_Vav2, Src homology 2 (SH2) domain found in the Vav2 proteins Back     alignment and domain information
>gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2 domain-containing adapter protein F (SHF) Back     alignment and domain information
>gnl|CDD|198275 cd10412, SH2_SH2B3, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) Back     alignment and domain information
>gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) Back     alignment and domain information
>gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family Back     alignment and domain information
>gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn Back     alignment and domain information
>gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr Back     alignment and domain information
>gnl|CDD|199830 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 2A and 7 (SH2D2A and SH2D7) Back     alignment and domain information
>gnl|CDD|198199 cd09946, SH2_HSH2_like, Src homology 2 domain found in hematopoietic SH2 (HSH2) protein Back     alignment and domain information
>gnl|CDD|198263 cd10400, SH2_SAP1a, Src homology 2 (SH2) domain found in SLAM-associated protein (SAP) 1a Back     alignment and domain information
>gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins Back     alignment and domain information
>gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK Back     alignment and domain information
>gnl|CDD|198252 cd10389, SH2_SHB, Src homology 2 domain found in SH2 domain-containing adapter protein B (SHB) Back     alignment and domain information
>gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family Back     alignment and domain information
>gnl|CDD|198247 cd10384, SH2_SOCS3, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198273 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) Back     alignment and domain information
>gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins Back     alignment and domain information
>gnl|CDD|198254 cd10391, SH2_SHE, Src homology 2 domain found in SH2 domain-containing adapter protein E (SHE) Back     alignment and domain information
>gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198269 cd10406, SH2_Vav2, Src homology 2 (SH2) domain found in the Vav2 proteins Back     alignment and domain information
>gnl|CDD|198246 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198205 cd10342, SH2_SAP1, Src homology 2 (SH2) domain found in SLAM-associated protein (SAP)1 Back     alignment and domain information
>gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn Back     alignment and domain information
>gnl|CDD|198245 cd10382, SH2_SOCS1, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198247 cd10384, SH2_SOCS3, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins Back     alignment and domain information
>gnl|CDD|198205 cd10342, SH2_SAP1, Src homology 2 (SH2) domain found in SLAM-associated protein (SAP)1 Back     alignment and domain information
>gnl|CDD|198270 cd10407, SH2_Vav3, Src homology 2 (SH2) domain found in the Vav3 proteins Back     alignment and domain information
>gnl|CDD|198199 cd09946, SH2_HSH2_like, Src homology 2 domain found in hematopoietic SH2 (HSH2) protein Back     alignment and domain information
>gnl|CDD|198285 cd10718, SH2_CIS, Src homology 2 (SH2) domain found in cytokine-inducible SH2-containing protein (CIS) Back     alignment and domain information
>gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain found in Fyn isoform a like proteins Back     alignment and domain information
>gnl|CDD|198221 cd10358, SH2_PTK6_Brk, Src homology 2 domain found in protein-tyrosine kinase-6 (PTK6) which is also known as breast tumor kinase (Brk) Back     alignment and domain information
>gnl|CDD|198221 cd10358, SH2_PTK6_Brk, Src homology 2 domain found in protein-tyrosine kinase-6 (PTK6) which is also known as breast tumor kinase (Brk) Back     alignment and domain information
>gnl|CDD|198250 cd10387, SH2_SOCS6, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins Back     alignment and domain information
>gnl|CDD|198259 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain found in Tec protein, IL2-inducible T-cell kinase (Itk) Back     alignment and domain information
>gnl|CDD|198214 cd10351, SH2_SH2D4B, Src homology 2 domain found in the SH2 domain containing protein 4B (SH2D4B) Back     alignment and domain information
>gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found in Tec protein, Bruton's tyrosine kinase (Btk) Back     alignment and domain information
>gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes Back     alignment and domain information
>gnl|CDD|198263 cd10400, SH2_SAP1a, Src homology 2 (SH2) domain found in SLAM-associated protein (SAP) 1a Back     alignment and domain information
>gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found in Tec protein, Bmx Back     alignment and domain information
>gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 451
KOG0790|consensus 600 100.0
PHA02742303 protein tyrosine phosphatase; Provisional 100.0
PHA02747312 protein tyrosine phosphatase; Provisional 100.0
PHA02740298 protein tyrosine phosphatase; Provisional 100.0
PHA02746323 protein tyrosine phosphatase; Provisional 100.0
PHA02738 320 hypothetical protein; Provisional 100.0
KOG4228|consensus 1087 100.0
KOG0792|consensus1144 100.0
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domai 100.0
KOG4228|consensus1087 100.0
KOG0791|consensus374 100.0
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze 100.0
KOG0793|consensus1004 100.0
PF00102235 Y_phosphatase: Protein-tyrosine phosphatase; Inter 100.0
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduc 100.0
PRK15375535 pathogenicity island 1 effector protein StpP; Prov 100.0
KOG0789|consensus 415 99.97
KOG1264|consensus 1267 99.97
KOG4637|consensus464 99.96
KOG4278|consensus 1157 99.86
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 99.84
KOG0197|consensus468 99.83
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 99.83
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 99.82
KOG0790|consensus600 99.71
KOG0194|consensus474 99.68
cd0017394 SH2 Src homology 2 domains; Signal transduction, i 99.66
KOG4226|consensus379 99.65
smart0025284 SH2 Src homology 2 domains. Src homology 2 domains 99.65
PF0001777 SH2: SH2 domain; InterPro: IPR000980 The Src homol 99.65
KOG4792|consensus293 99.51
KOG2996|consensus865 99.48
KOG1264|consensus 1267 99.42
KOG4226|consensus379 99.41
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 99.36
KOG4278|consensus 1157 99.36
KOG4637|consensus 464 99.35
KOG1930|consensus483 99.26
KOG2996|consensus865 99.24
KOG0197|consensus468 99.1
KOG4792|consensus293 99.08
KOG1856|consensus1299 99.05
KOG3601|consensus222 98.99
KOG0194|consensus 474 98.66
KOG3601|consensus222 98.59
KOG1930|consensus483 98.52
KOG3697|consensus345 98.31
KOG3751|consensus622 98.3
KOG4566|consensus258 97.54
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic 97.28
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic 97.28
KOG3751|consensus622 96.88
KOG3697|consensus345 96.63
PF14633220 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ 95.71
PF0276286 Cbl_N3: CBL proto-oncogene N-terminus, SH2-like do 94.98
KOG4566|consensus258 92.71
KOG1856|consensus1299 90.95
PTZ00242166 protein tyrosine phosphatase; Provisional 90.83
KOG2836|consensus173 84.68
KOG3508|consensus 932 83.11
>KOG0790|consensus Back     alignment and domain information 
Probab=100.00  E-value=9.1e-97  Score=681.78  Aligned_cols=424  Identities=72%  Similarity=1.176  Sum_probs=402.2

Q ss_pred             CCCCccCCCCCHHHHHHHHhcCCCCCeEEEeecCCCCCceEEEEEECCeEEEEEEEeeCCeEEecCCcccCCHHHHHHHH
Q psy8516           2 SSRRWFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQFY   81 (451)
Q Consensus         2 ~~~~wy~g~isr~~Ae~lL~~~~~~G~flvR~s~~~~~~~~ls~~~~~~~~h~~I~~~~~~~~~~~~~~f~sl~~Lv~~y   81 (451)
                      .+..|||..|+-.+||.||+..+.+|+||.|.|++++|+|+||++.++++.|++|...++.|.+.+++.|.++.+||+||
T Consensus         2 ~s~~wfh~~~~g~~ae~Ll~~~g~dgsfl~r~s~sNp~~fsl~~r~~~~v~hikiq~~~~~~~l~~gekfat~~ELvqyy   81 (600)
T KOG0790|consen    2 TSRRWFHPDLSGVEAETLLKERGVDGSFLARPSESNPGDFSLSVRRGDKVTHIKIQNSGDFYDLYGGEKFATLAELVQYY   81 (600)
T ss_pred             cchhhcCCCccchhHHHHHHHhccccchhhccccCCCcceeEEEEeCCceEEEEEeecCccccccCCccccchHHHHHHH
Confidence            46789999999999999999999999999999999999999999999999999999888889999999999999999999


Q ss_pred             HhccccccccccceeeecCCCCCCCCCccccccCCcchHHHHHHHHHcCCCCCcccccCchHHHHHHHHhcCCCceEEEe
Q psy8516          82 MENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVR  161 (451)
Q Consensus        82 ~~~~~~l~~~~~~~i~L~~Pv~~~~~~~~~w~~~~~~~~~ae~~l~~~~~~g~fg~~~~~~~~a~~~l~~~~~~G~flvR  161 (451)
                      +.+.+.|....|..+.|++|+.|.+|..+.||||.++..+||.+|.+++                       ++|+||||
T Consensus        82 me~~~~lkekng~~ielK~pl~cAdptserWfHG~LsgkeAekLl~ekg-----------------------k~gsfLvR  138 (600)
T KOG0790|consen   82 MEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLQEKG-----------------------KHGSFLVR  138 (600)
T ss_pred             HhhhHHHHhcCCCEEEecCCCccCCchhhhhhccCCCchhHHHHHHhcC-----------------------CCccEEEe
Confidence            9999999999999999999999999999999999999999999998877                       79999999


Q ss_pred             cCCCCCCCeEEEEEeCC---------eeeeEEEEEeCCeEEecCCcccccHHHHHHhhhcCCcccccceeEEeccccccc
Q psy8516         162 ESQSKPGDFVLSVRTDD---------KVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNAT  232 (451)
Q Consensus       162 ~s~~~~~~~~ls~~~~~---------~v~h~~I~~~~~~~~~~~~~~F~sl~~Li~~y~~~~lv~~~g~~~~L~~p~~~t  232 (451)
                      +|.+.||+|+||++.++         +|.|+.|.|.+++|.++++..|+|+.+||+||+.+++++..|.++.|++|+..|
T Consensus       139 eSqs~PGdfVlSvrTdd~~~~~~~~~kVtHvmI~~q~~kydVGgge~F~sltdLidhykknpmvEt~gtvv~LrqP~naT  218 (600)
T KOG0790|consen  139 ESQSHPGDFVLSVRTDDKKESNDSKLKVTHVMIRCQEGKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVVYLRQPLNAT  218 (600)
T ss_pred             ccccCCCceEEEEEcCCcccCCCCccceEEEEEEecccccccCCccccchHHHHHHHhccCchhhhcceeEEeecccccc
Confidence            99999999999999976         899999999999999999999999999999999999999999999999999999


Q ss_pred             cccccchhhhHHHhhhccC----CCccchHHHHhhhcccccccccccccccccCCCCCCCCCCCCCCCCceEecCCCCCC
Q psy8516         233 RITVSNIHDRVTELQKENS----SKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDEDV  308 (451)
Q Consensus       233 ~i~~~~l~~~v~~l~~~~~----~~~~~~~ef~~l~~~~~~~~~~~~~~~~~~n~~knR~~~i~p~d~~rv~l~~~~~~~  308 (451)
                      .|.++.|..++.+|.++..    .++||++||+.|+.+++...+++..+..++|+.||||.||+|||||||+|.+.+++.
T Consensus       219 rI~Aa~i~~Rve~l~k~~e~~d~~k~GfwEEFesLqq~~~~~~~sr~EG~r~eN~~KNRYkNIlPfDHtRViL~d~~~n~  298 (600)
T KOG0790|consen  219 RINAADIENRVEELNKKQESEDTAKAGFWEEFESLQQQEVKNLHSRLEGQRPENKGKNRYKNILPFDHTRVILQDRDPNI  298 (600)
T ss_pred             chhhhhHHHHHHHHhccccchhhhhcchhHHHHHhhhhhhHhhhhhhccccchhhccccccccCcccceeeEeecCCCCC
Confidence            9999999999999988644    788999999999998888888999999999999999999999999999999988899


Q ss_pred             CCCCceeeEEeecC--------CCCceEEEeCCCCcccHHHHHhHhhcccceEEEeeccccccCcccceeecCCCCCceE
Q psy8516         309 PGAEYINANYIQSE--------DGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKT  380 (451)
Q Consensus       309 ~~~~yinAs~v~~~--------~~~~~~I~tQ~P~~~t~~dFW~mv~~~~~~~Iv~l~~~~e~~~~~c~~YwP~~~~~~~  380 (451)
                      +++||||||||-.-        ..++.||||||-|.+|+.|||+|||++|+++|||-|...|.|++||.+|||+++....
T Consensus       299 pgsdYINAnyi~~~~q~~~~~~~~kKsyIAtQGCL~nTVnDFW~MvwQENsrVIVMtTkE~ERgK~KC~~YWPee~~~e~  378 (600)
T KOG0790|consen  299 PGSDYINANYIMIEFQRLCNNSKPKKSYIATQGCLQNTVNDFWRMVWQENSRVIVMTTKEVERGKSKCVKYWPEEGALEE  378 (600)
T ss_pred             ccchhcccchhhhhhhhccCccccccceeehhhHHHHHHHHHHHHHHhccceEEEEehhhhhcccccccccCCcccchhh
Confidence            99999999998532        1346899999999999999999999999999999999999999999999999888889


Q ss_pred             EeeEEEEEeeeeeecCEEEEEEEEEeCC--CCCEEEEEEeeCCCCCCCCCCChHHHHHHHHHHHhhhccc
Q psy8516         381 YGAVCVNNMYESVTTDYILREFLVSKGS--ESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDIH  448 (451)
Q Consensus       381 ~~~~~v~~~~~~~~~~~~~~~l~v~~~~--~~~~~v~~~~~~~Wp~~~~P~~~~~~l~~~~~v~~~~~~~  448 (451)
                      ||.+.|++.++....+|+.|+|.++...  ...|.|+||||..|||||||.+|..+|+|+++|+..|+..
T Consensus       379 ~G~~~v~~v~E~~t~dY~LR~l~vs~~~~g~~~R~I~~yh~~tWPDHGvP~dPg~vLnFLe~V~~rq~~l  448 (600)
T KOG0790|consen  379 YGVMRVRNVKESDTHDYTLRELKVSKLGNGNLEREIWHYHYLTWPDHGVPSDPGGVLNFLEEVNHRQESL  448 (600)
T ss_pred             cCceEEEeccccccccceehheeeccccCCcchhhhhhhheeecccCCCcCCccHHHHHHHHhhhhhccc
Confidence            9999999999999999999999998543  6789999999999999999999999999999999998754

>PHA02742 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02747 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02740 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02746 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>PHA02738 hypothetical protein; Provisional Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG0792|consensus Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>KOG0791|consensus Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>KOG0793|consensus Back     alignment and domain information
>PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>PRK15375 pathogenicity island 1 effector protein StpP; Provisional Back     alignment and domain information
>KOG0789|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>KOG0790|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>smart00252 SH2 Src homology 2 domains Back     alignment and domain information
>PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG4637|consensus Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG1856|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>KOG3697|consensus Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>KOG4566|consensus Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>KOG3751|consensus Back     alignment and domain information
>KOG3697|consensus Back     alignment and domain information
>PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A Back     alignment and domain information
>PF02762 Cbl_N3: CBL proto-oncogene N-terminus, SH2-like domain; InterPro: IPR014742 Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface Back     alignment and domain information
>KOG4566|consensus Back     alignment and domain information
>KOG1856|consensus Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>KOG2836|consensus Back     alignment and domain information
>KOG3508|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query451
2shp_A525 Tyrosine Phosphatase Shp-2 Length = 525 1e-170
3ps5_A 595 Crystal Structure Of The Full-Length Human Protein 1e-142
2b3o_A532 Crystal Structure Of Human Tyrosine Phosphatase Shp 1e-141
3b7o_A316 Crystal Structure Of The Human Tyrosine Phosphatase 5e-67
4gry_A288 Crystal Structure Of Shp1 Catalytic Domain With Jak 2e-63
4gs0_A308 Crystal Structure Of Shp1 Catalytic Domain With Jak 2e-63
1gwz_A299 Crystal Structure Of The Catalytic Domain Of The Pr 3e-63
1fpr_A284 Crystal Structure Of The Complex Formed Between The 3e-63
3o5x_A276 Crystal Structure Of The Oncogenic Tyrosine Phospha 1e-58
3tl0_A109 Structure Of Shp2 N-Sh2 Domain In Complex With Rlnp 1e-47
3tl0_A109 Structure Of Shp2 N-Sh2 Domain In Complex With Rlnp 1e-17
1aya_A101 Crystal Structures Of Peptide Complexes Of The Amin 8e-44
1aya_A101 Crystal Structures Of Peptide Complexes Of The Amin 5e-17
2ooq_A286 Crystal Structure Of The Human Receptor Phosphatase 1e-39
2h02_A313 Structural Studies Of Protein Tyrosine Phosphatase 2e-39
3s3e_A307 Crystal Structure Of The Catalytic Domain Of Ptp10d 2e-39
2ahs_A295 Crystal Structure Of The Catalytic Domain Of Human 3e-39
1rpm_A278 Human Receptor Protein Tyrosine Phosphatase Mu, Dom 5e-37
1lar_A 575 Crystal Structure Of The Tandem Phosphatase Domains 6e-37
3olr_A313 Ptpn22 In Complex With Consensus Phospho-Tyrosine P 9e-37
3i36_A 342 Crystal Structure Of Rat Protein Tyrosine Phosphata 1e-36
2qcj_A313 Native Structure Of Lyp Length = 313 1e-36
2p6x_A309 Crystal Structure Of Human Tyrosine Phosphatase Ptp 1e-36
3h2x_A302 Crystal Structure Of The Human Lymphoid Tyrosine Ph 1e-36
2h03_A291 Structural Studies Of Protein Tyrosine Phosphatase 1e-36
2c7s_A313 Crystal Structure Of Human Protein Tyrosine Phospha 2e-36
2nv5_A299 Crystal Structure Of A C-Terminal Phosphatase Domai 2e-36
2pbn_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 2e-36
2jjd_A 599 Protein Tyrosine Phosphatase, Receptor Type, E Isof 3e-36
2nz6_A316 Crystal Structure Of The Ptprj Inactivating Mutant 3e-36
3qcl_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 4e-36
3qcb_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 5e-36
2nlk_A 627 Crystal Structure Of D1 And D2 Catalytic Domains Of 6e-36
2h4v_A320 Crystal Structure Of The Human Tyrosine Receptor Ph 7e-36
3brh_A310 Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To 8e-36
3qcm_A310 Human Receptor Protein Tyrosine Phosphatase Gamma, 1e-35
3sr9_A 583 Crystal Structure Of Mouse Ptpsigma Length = 583 5e-35
1ptu_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 6e-35
1ptv_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 6e-35
1l8g_A 321 Crystal Structure Of Ptp1b Complexed With 7-(1,1-di 7e-35
2hy3_A313 Crystal Structure Of The Human Tyrosine Receptor Ph 8e-35
1c86_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 9e-35
1ecv_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 9e-35
1gfy_A298 Residue 259 Is A Key Determinant Of Substrate Speci 9e-35
2cfv_A316 Crystal Structure Of Human Protein Tyrosine Phospha 1e-34
3zv2_A 320 Human Protein-Tyrosine Phosphatase 1b C215a, S216a 1e-34
1oeo_X 321 Ptp1b With The Catalytic Cysteine Oxidized To Sulfo 2e-34
3eu0_A 327 Crystal Structure Of The S-Nitrosylated Cys215 Of P 2e-34
4i8n_A 354 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-34
1yfo_A302 Receptor Protein Tyrosine Phosphatase Alpha, Domain 2e-34
1een_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-34
1aax_A 321 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-34
1bzc_A 321 Human Ptp1b Catalytic Domain Complexed With Tpi Len 2e-34
2cma_A 327 Structural Basis For Inhibition Of Protein Tyrosine 2e-34
1nl9_A 321 Potent, Selective Protein Tyrosine Phosphatase 1b I 2e-34
1g1f_A298 Crystal Structure Of Protein Tyrosine Phosphatase 1 2e-34
1bzh_A298 Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 2e-34
1g7g_A298 Human Ptp1b Catalytic Domain Complexes With Pnu1793 2e-34
2cm2_A304 Structure Of Protein Tyrosine Phosphatase 1b (P2121 2e-34
1a5y_A 330 Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate 2e-34
3sme_A300 Structure Of Ptp1b Inactivated By H2o2BICARBONATE L 2e-34
2azr_A299 Crystal Structure Of Ptp1b With Bicyclic Thiophene 2e-34
1g7f_A298 Human Ptp1b Catalytic Domain Complexed With Pnu1774 2e-34
2nt7_A299 Crystal Structure Of Ptp1b-inhibitor Complex Length 2e-34
1bzj_A297 Human Ptp1b Complexed With Tpicooh Length = 297 2e-34
1nwl_A298 Crystal Structure Of The Ptp1b Complexed With Sp734 2e-34
3cwe_A290 Ptp1b In Complex With A Phosphonic Acid Inhibitor L 3e-34
1lqf_A295 Structure Of Ptp1b In Complex With A Peptidic Bisph 4e-34
2f6f_A302 The Structure Of The S295f Mutant Of Human Ptp1b Le 4e-34
2fh7_A 595 Crystal Structure Of The Phosphatase Domains Of Hum 4e-34
1i57_A310 Crystal Structure Of Apo Human Ptp1b (C215s) Mutant 4e-34
2fjm_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 4e-34
1q6j_A310 The Structure Of Phosphotyrosine Phosphatase 1b In 4e-34
1pa1_A310 Crystal Structure Of The C215d Mutant Of Protein Ty 5e-34
1ygr_A 610 Crystal Structure Of The Tandem Phosphatase Domain 6e-34
2pi7_A312 Structure Of The Catalytic Domain Of The Chick Reti 1e-33
1l8k_A 314 T Cell Protein-Tyrosine Phosphatase Structure Lengt 1e-33
2oc3_A303 Crystal Structure Of The Catalytic Domain Of Human 1e-33
3qkp_A 321 Protein Tyrosine Phosphatase 1b - Apo W179f Mutant 2e-33
2g59_A297 Crystal Structure Of The Catalytic Domain Of Protei 3e-33
2gjt_A295 Crystal Structure Of The Human Receptor Phosphatase 4e-33
3a5k_A304 Crystal Structure Of Protein-Tyrosine Phosphatase 1 5e-33
2i75_A320 Crystal Structure Of Human Protein Tyrosine Phospha 7e-30
2b49_A287 Crystal Structure Of The Catalytic Domain Of Protei 3e-29
3d42_A308 Crystal Structure Of Heptp In Complex With A Monoph 1e-28
1wch_A315 Crystal Structure Of Ptpl1 Human Tyrosine Phosphata 1e-28
2hvl_A309 Crystal Structure Of The Heptp Catalytic Domain C27 2e-28
1zc0_A309 Crystal Structure Of Human Hematopoietic Tyrosine P 2e-28
2a3k_A296 Crystal Structure Of The Human Protein Tyrosine Pho 2e-28
3o4s_A308 Crystal Structure Of Heptp With A Closed Wpd Loop A 2e-28
2gp0_A309 Heptp Catalytic Domain (Residues 44-339), S225d Mut 2e-28
2pa5_A314 Crystal Structure Of Human Protein Tyrosine Phospha 4e-28
2cjz_A305 Crystal Structure Of The C472s Mutant Of Human Prot 5e-28
2bij_A305 Crystal Structure Of The Human Protein Tyrosine Pho 6e-28
2bv5_A282 Crystal Structure Of The Human Protein Tyrosine Pho 6e-28
2qdm_A309 Crystal Structure Of The Heptp Catalytic Domain C27 1e-27
2qdc_A309 Crystal Structure Of The Heptp Catalytic Domain D23 1e-27
2bzl_A325 Crystal Structure Of The Human Protein Tyrosine Pho 5e-27
1p15_A253 Crystal Structure Of The D2 Domain Of Rptpa Length 2e-26
2i1y_A301 Crystal Structure Of The Phosphatase Domain Of Huma 4e-26
2qep_A304 Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be 5e-26
1jln_A297 Crystal Structure Of The Catalytic Domain Of Protei 2e-25
2a8b_A283 Crystal Structure Of The Catalytic Domain Of Human 4e-25
1x6c_A118 Solution Structures Of The Sh2 Domain Of Human Prot 6e-20
3gqi_B226 Crystal Structure Of Activated Receptor Tyrosine Ki 2e-16
4fbn_A246 Insights Into Structural Integration Of The Plcgamm 6e-16
4ey0_A246 Structure Of Tandem Sh2 Domains From Plcgamma1 Leng 7e-16
4az1_A302 Crystal Structure Of The Trypanosoma Cruzi Protein 2e-15
3m4u_A306 Crystal Structure Of Trypanosoma Brucei Protein Tyr 3e-13
2ci8_A99 Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomple 9e-11
2ci8_A99 Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomple 6e-08
1z3k_A98 Structural Insight Into The Binding Diversity Betwe 1e-10
1z3k_A98 Structural Insight Into The Binding Diversity Betwe 5e-07
2ci9_A102 Nck1 Sh2-Domain In Complex With A Dodecaphosphopept 2e-10
2ci9_A102 Nck1 Sh2-Domain In Complex With A Dodecaphosphopept 6e-08
4fl3_A 635 Structural And Biophysical Characterization Of The 5e-10
4fl2_A 636 Structural And Biophysical Characterization Of The 5e-10
1gri_A217 Grb2 Length = 217 5e-10
1gri_A217 Grb2 Length = 217 5e-07
3n84_A112 Crystal Structure Of The Grb2 Sh2 Domain In Complex 5e-10
3n84_A112 Crystal Structure Of The Grb2 Sh2 Domain In Complex 5e-06
1bm2_A117 Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet 6e-10
1bm2_A117 Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet 4e-06
3ove_A117 Crystal Structure Of The Grb2 Sh2 Domain In Complex 6e-10
3ove_A117 Crystal Structure Of The Grb2 Sh2 Domain In Complex 5e-06
3imd_A117 Crystal Structure Of The Grb2 Sh2 Domain In Complex 6e-10
3imd_A117 Crystal Structure Of The Grb2 Sh2 Domain In Complex 5e-06
2h46_E116 Native Domain-Swapped Dimer Crystal Structure Of Th 6e-10
2h46_E116 Native Domain-Swapped Dimer Crystal Structure Of Th 5e-06
2cia_A102 Human Nck2 Sh2-Domain In Complex With A Decaphospho 6e-10
2cia_A102 Human Nck2 Sh2-Domain In Complex With A Decaphospho 5e-07
1fhs_A112 The Three-Dimensional Solution Structure Of The Src 6e-10
1fhs_A112 The Three-Dimensional Solution Structure Of The Src 5e-06
1bmb_A123 Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 6e-10
1bmb_A123 Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 4e-06
2aoa_A99 Crystal Structures Of A High-affinity Macrocyclic P 6e-10
2aoa_A99 Crystal Structures Of A High-affinity Macrocyclic P 4e-06
1fyr_A114 Dimer Formation Through Domain Swapping In The Crys 6e-10
1fyr_A114 Dimer Formation Through Domain Swapping In The Crys 4e-06
3mxc_A101 Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp 7e-10
3mxc_A101 Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp 4e-06
1tze_E98 Signal Transduction Adaptor Growth Factor, Grb2 Sh2 7e-10
1tze_E98 Signal Transduction Adaptor Growth Factor, Grb2 Sh2 4e-06
1a81_A254 Crystal Structure Of The Tandem Sh2 Domain Of The S 7e-10
1x0n_A104 Nmr Structure Of Growth Factor Receptor Binding Pro 9e-10
1x0n_A104 Nmr Structure Of Growth Factor Receptor Binding Pro 5e-06
1jyq_A96 Xray Structure Of Grb2 Sh2 Domain Complexed With A 1e-09
1jyq_A96 Xray Structure Of Grb2 Sh2 Domain Complexed With A 4e-06
1zfp_E98 Growth Factor Receptor Binding Protein Sh2 Domain C 1e-09
1zfp_E98 Growth Factor Receptor Binding Protein Sh2 Domain C 4e-06
1cj1_A96 Growth Factor Receptor Binding Protein Sh2 Domain ( 1e-09
1cj1_A96 Growth Factor Receptor Binding Protein Sh2 Domain ( 4e-06
2aug_A126 Crystal Structure Of The Grb14 Sh2 Domain Length = 1e-09
2aug_A126 Crystal Structure Of The Grb14 Sh2 Domain Length = 4e-06
1ghu_A107 Nmr Solution Structure Of Growth Factor Receptor-Bo 1e-09
1ghu_A107 Nmr Solution Structure Of Growth Factor Receptor-Bo 2e-06
2fci_A105 Structural Basis For The Requirement Of Two Phospho 2e-09
2fci_A105 Structural Basis For The Requirement Of Two Phospho 4e-07
3eaz_A106 Crystal Structure Of Sh2 Domain Of Human Csk (Carbo 4e-09
3eac_A106 Crystal Structure Of Sh2 Domain Of Human Csk (Carbo 6e-09
1r1p_A100 Structural Basis For Differential Recognition Of Ty 6e-09
1r1p_A100 Structural Basis For Differential Recognition Of Ty 2e-06
2gsb_A119 Solution Structure Of The Second Sh2 Domain Of Huma 2e-08
2gsb_A119 Solution Structure Of The Second Sh2 Domain Of Huma 3e-07
2lct_A107 Solution Structure Of The Vav1 Sh2 Domain Complexed 2e-08
2lct_A107 Solution Structure Of The Vav1 Sh2 Domain Complexed 2e-04
2crh_A138 Solution Structure Of The Sh2 Domain Of Human Proto 3e-08
2crh_A138 Solution Structure Of The Sh2 Domain Of Human Proto 3e-04
1k9a_A450 Crystal Structure Analysis Of Full-Length Carboxyl- 4e-08
2lqn_A303 Solution Structure Of Crkl Length = 303 4e-08
2lqw_A303 Solution Structure Of Phosphorylated Crkl Length = 4e-08
2eo3_A111 Solution Structure Of The Sh2 Domain From Human Crk 4e-08
3s9k_A118 Crystal Structure Of The Itk Sh2 Domain Length = 11 4e-08
3t04_A123 Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN C 7e-08
3k2m_A112 Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN CO 8e-08
2ecd_A119 Solution Structure Of The Human Abl2 Sh2 Domain Len 8e-08
2ecd_A119 Solution Structure Of The Human Abl2 Sh2 Domain Len 2e-06
2abl_A163 Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine K 1e-07
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 2e-07
2fo0_A495 Organization Of The Sh3-Sh2 Unit In Active And Inac 3e-07
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-07
1opk_A495 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-07
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 2e-07
1opl_A537 Structural Basis For The Auto-Inhibition Of C-Abl T 3e-07
1mw4_A120 Solution Structure Of The Human Grb7-Sh2 Domain In 3e-07
3pqz_A117 Grb7 Sh2 With Peptide Length = 117 3e-07
1ab2_A109 Three-Dimensional Solution Structure Of The Src Hom 3e-07
1ab2_A109 Three-Dimensional Solution Structure Of The Src Hom 8e-07
2ozo_A 613 Autoinhibited Intact Human Zap-70 Length = 613 4e-07
2oq1_A254 Tandem Sh2 Domains Of Zap-70 With 19-Mer Zeta1 Pept 4e-07
2oq1_A254 Tandem Sh2 Domains Of Zap-70 With 19-Mer Zeta1 Pept 5e-04
1lui_A110 Nmr Structures Of Itk Sh2 Domain, Pro287cis Isoform 4e-07
2etz_A109 The Nmr Minimized Average Structure Of The Itk Sh2 4e-07
1m61_A259 Crystal Structure Of The Apo Sh2 Domains Of Zap-70 4e-07
2k79_B110 Solution Structure Of The Binary Complex Between Th 5e-07
2dx0_A138 Crystal Structure Of The N-Terminal Sh2 Domain Of M 5e-07
2kk6_A116 Solution Structure Of Sh2 Domain Of Proto-Oncogene 1e-06
1jwo_A97 Crystal Structure Analysis Of The Sh2 Domain Of The 1e-06
1jwo_A97 Crystal Structure Analysis Of The Sh2 Domain Of The 4e-06
2eob_A124 Solution Structure Of The Second Sh2 Domain From Ra 4e-06
3us4_A98 Crystal Structure Of A Sh2 Domain Of A Megakaryocyt 4e-06
3us4_A98 Crystal Structure Of A Sh2 Domain Of A Megakaryocyt 1e-05
2hdv_A111 Crystal Structure Of The Src Homology-2 Domain Of T 5e-06
3m7f_A108 Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX 5e-06
3m7f_A108 Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX 5e-05
1nrv_A105 Crystal Structure Of The Sh2 Domain Of Grb10 Length 6e-06
1nrv_A105 Crystal Structure Of The Sh2 Domain Of Grb10 Length 7e-05
1csy_A112 Syk Tyrosine Kinase C-Terminal Sh2 Domain Complexed 7e-06
1ju5_A109 Ternary Complex Of An Crk Sh2 Domain, Crk-Derived P 7e-06
2eyz_A304 Ct10-Regulated Kinase Isoform Ii Length = 304 8e-06
2dvj_A230 Phosphorylated Crk-Ii Length = 230 9e-06
2eyy_A204 Ct10-Regulated Kinase Isoform I Length = 204 9e-06
2eyv_A124 Sh2 Domain Of Ct10-Regulated Kinase Length = 124 9e-06
1g83_A165 Crystal Structure Of Fyn Sh3-Sh2 Length = 165 1e-05
1tce_A107 Solution Nmr Structure Of The Shc Sh2 Domain Comple 1e-05
1mil_A104 Transforming Protein Length = 104 2e-05
2ysx_A119 Solution Structure Of The Human Ship Sh2 Domain Len 2e-05
1aot_F106 Nmr Structure Of The Fyn Sh2 Domain Complexed With 2e-05
2dly_A121 Solution Structure Of The Sh2 Domain Of Murine Fyn- 3e-05
2dly_A121 Solution Structure Of The Sh2 Domain Of Murine Fyn- 4e-05
3uf4_A164 Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P 3e-05
3cd3_A377 Crystal Structure Of Phosphorylated Human Feline Sa 4e-05
3bkb_A377 Crystal Structure Of Human Feline Sarcoma Viral Onc 4e-05
1wqu_A114 Solution Structure Of The Human Fes Sh2 Domain Leng 4e-05
4f59_A112 Triple Mutant Src Sh2 Domain Length = 112 6e-05
2lnw_A122 Identification And Structural Basis For A Novel Int 6e-05
2dlz_A118 Solution Structure Of The Sh2 Domain Of Human Prote 7e-05
2dlz_A118 Solution Structure Of The Sh2 Domain Of Human Prote 7e-05
1h9o_A112 Phosphatidylinositol 3-Kinase, P85-Alpha Subunit: C 1e-04
1qad_A111 Crystal Structure Of The C-Terminal Sh2 Domain Of T 1e-04
1bfi_A112 Solution Structure Of The C-Terminal Sh2 Domain Of 1e-04
1o41_A108 Crystal Structure Of Sh2 In Complex With Ru78300. L 1e-04
1cwd_L98 Human P56lck Tyrosine Kinase Complexed With Phospho 1e-04
1shd_A107 Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein In 1e-04
1y57_A452 Structure Of Unphosphorylated C-Src In Complex With 1e-04
2ekx_A110 Solution Structure Of The Human Bmx Sh2 Domain Leng 1e-04
1fmk_A452 Crystal Structure Of Human Tyrosine-Protein Kinase 2e-04
1ksw_A452 Structure Of Human C-Src Tyrosine Kinase (Thr338gly 2e-04
1o4c_A108 Crystal Structure Of Sh2 In Complex With Phosphate. 2e-04
2ge9_A125 Solution Structures Of The Sh2 Domain Of Bruton's T 2e-04
2h8h_A535 Src Kinase In Complex With A Quinazoline Inhibitor 2e-04
2dm0_A125 Solution Structure Of The Sh2 Domain Of Human Tyros 2e-04
1blj_A114 Nmr Ensemble Of Blk Sh2 Domain, 20 Structures Lengt 2e-04
1blj_A114 Nmr Ensemble Of Blk Sh2 Domain, 20 Structures Lengt 7e-04
1skj_A113 Cocrystal Structure Of Urea-Substituted Phosphopept 2e-04
1ijr_A104 Crystal Structure Of Lck Sh2 Complexed With Nonpept 2e-04
1a1a_A107 C-Src (Sh2 Domain With C188a Mutation) Complexed Wi 2e-04
1nzl_A103 Crystal Structure Of Src Sh2 Domain Bound To Doubly 2e-04
1p13_A102 Crystal Structure Of The Src Sh2 Domain Complexed W 2e-04
1fbz_A104 Structure-Based Design Of A Novel, Osteoclast-Selec 2e-04
1is0_A106 Crystal Structure Of A Complex Of The Src Sh2 Domai 2e-04
1f1w_A104 Src Sh2 Thref1trp Mutant Complexed With The Phospho 2e-04
1sha_A104 Crystal Structure Of The Phosphotyrosine Recognitio 3e-04
1bkl_A113 Self-Associated Apo Src Sh2 Domain Length = 113 3e-04
1bkm_A113 Cocrystal Structure Of D-Amino Acid Substituted Pho 3e-04
2ptk_A453 Chicken Src Tyrosine Kinase Length = 453 3e-04
1lcj_A109 Sh2 (Src Homology-2) Domain Of Human P56-Lck Tyrosi 4e-04
3nhn_A193 Crystal Structure Of The Src-Family Kinase Hck Sh3- 4e-04
1bhf_A108 P56lck Sh2 Domain Inhibitor Complex Length = 108 4e-04
1lkk_A105 Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex 4e-04
1lkl_A104 Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex 4e-04
1bhh_B103 Free P56lck Sh2 Domain Length = 103 4e-04
2cs0_A119 Solution Structure Of The Sh2 Domain Of Human Hsh2d 5e-04
1qcf_A454 Crystal Structure Of Hck In Complex With A Src Fami 5e-04
1ad5_A438 Src Family Kinase Hck-Amp-Pnp Complex Length = 438 5e-04
1lck_A175 Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine K 6e-04
4d8k_A175 Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphoc 7e-04
1x27_A167 Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding S 7e-04
1kc2_A103 Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c 9e-04
>pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 Back     alignment and structure 
Iteration: 1

 Score =  593 bits (1530), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 298/470 (63%), Positives = 349/470 (74%), Gaps = 47/470 (10%)
Query: 1   MSSRRWFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTG 60
           M SRRWFHP+I+GVEAE LLL RG DGSFL RPS+SNPGD TLSVR NG VTHIKIQNTG
Sbjct: 1   MKSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDLTLSVRRNGAVTHIKIQNTG 60
Query: 61  DCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGK 120
           D YDLYGGEKFATL+ELVQ+YME+ GQLK++N +VIELKYPL+CADPT+ERWFHG LSGK
Sbjct: 61  DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK 120
Query: 121 EAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDD-- 178
           EAE+L+ +KGK+GSFL                       VRESQS PGDFVLSVRT D  
Sbjct: 121 EAEKLLTEKGKHGSFL-----------------------VRESQSHPGDFVLSVRTGDDK 157
Query: 179 --------KVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFN 230
                   KVTHVMIRCQ  KYDVGGGE+FDSLT L+EHYK+NPMVET GTV+ LKQP N
Sbjct: 158 GESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLN 217
Query: 231 ATRITVSNIHDRVTELQK----ENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKN 286
            TRI  + I  RV EL K     +  K GFWEEFE+LQQQE + L++R+EGQ+ +N+NKN
Sbjct: 218 TTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKN 277
Query: 287 RYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSE--------DGGKSYIATQGCLPST 338
           RYKNILPFDHTRV L D D + P ++YINAN I  E           KSYIATQGCL +T
Sbjct: 278 RYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNT 337
Query: 339 MNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYI 398
           +NDFW MV+QEN RVIVMTTKE+ERGK+KC KYWPD++  K YG + V N+ ES   DY 
Sbjct: 338 VNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYT 397
Query: 399 LREFLVSKGSE--SPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQD 446
           LRE  +SK  +  + R ++ YHF+ WPDHGVPSDPG VL+FL EV+ +Q+
Sbjct: 398 LRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQE 447
>pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 Back     alignment and structure
>pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 Back     alignment and structure
>pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 Back     alignment and structure
>pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 Back     alignment and structure
>pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 Back     alignment and structure
>pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 Back     alignment and structure
>pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 Back     alignment and structure
>pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 Back     alignment and structure
>pdb|3TL0|A Chain A, Structure Of Shp2 N-Sh2 Domain In Complex With Rlnpyaqlwhr Peptide Length = 109 Back     alignment and structure
>pdb|3TL0|A Chain A, Structure Of Shp2 N-Sh2 Domain In Complex With Rlnpyaqlwhr Peptide Length = 109 Back     alignment and structure
>pdb|1AYA|A Chain A, Crystal Structures Of Peptide Complexes Of The Amino- Terminal Sh2 Domain Of The Syp Tyrosine Phosphatase Length = 101 Back     alignment and structure
>pdb|1AYA|A Chain A, Crystal Structures Of Peptide Complexes Of The Amino- Terminal Sh2 Domain Of The Syp Tyrosine Phosphatase Length = 101 Back     alignment and structure
>pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 Back     alignment and structure
>pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 Back     alignment and structure
>pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 Back     alignment and structure
>pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 Back     alignment and structure
>pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 Back     alignment and structure
>pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 Back     alignment and structure
>pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 Back     alignment and structure
>pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 Back     alignment and structure
>pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 Back     alignment and structure
>pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 Back     alignment and structure
>pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 Back     alignment and structure
>pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 Back     alignment and structure
>pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 Back     alignment and structure
>pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 Back     alignment and structure
>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 Back     alignment and structure
>pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 Back     alignment and structure
>pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 Back     alignment and structure
>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 Back     alignment and structure
>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 Back     alignment and structure
>pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 Back     alignment and structure
>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 Back     alignment and structure
>pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 Back     alignment and structure
>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 Back     alignment and structure
>pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 Back     alignment and structure
>pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 Back     alignment and structure
>pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 Back     alignment and structure
>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 Back     alignment and structure
>pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 Back     alignment and structure
>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 Back     alignment and structure
>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 Back     alignment and structure
>pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 Back     alignment and structure
>pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 Back     alignment and structure
>pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 Back     alignment and structure
>pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 Back     alignment and structure
>pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 Back     alignment and structure
>pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 Back     alignment and structure
>pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 Back     alignment and structure
>pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 Back     alignment and structure
>pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 Back     alignment and structure
>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 Back     alignment and structure
>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 Back     alignment and structure
>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 Back     alignment and structure
>pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 Back     alignment and structure
>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 Back     alignment and structure
>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 Back     alignment and structure
>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 Back     alignment and structure
>pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 Back     alignment and structure
>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 Back     alignment and structure
>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 Back     alignment and structure
>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 Back     alignment and structure
>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 Back     alignment and structure
>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 Back     alignment and structure
>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 Back     alignment and structure
>pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 Back     alignment and structure
>pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 Back     alignment and structure
>pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 Back     alignment and structure
>pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 Back     alignment and structure
>pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 Back     alignment and structure
>pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 Back     alignment and structure
>pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 Back     alignment and structure
>pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 Back     alignment and structure
>pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 Back     alignment and structure
>pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 Back     alignment and structure
>pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 Back     alignment and structure
>pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 Back     alignment and structure
>pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 Back     alignment and structure
>pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 Back     alignment and structure
>pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 Back     alignment and structure
>pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 Back     alignment and structure
>pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 Back     alignment and structure
>pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 Back     alignment and structure
>pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 Back     alignment and structure
>pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 Back     alignment and structure
>pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 Back     alignment and structure
>pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 Back     alignment and structure
>pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 Back     alignment and structure
>pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 Back     alignment and structure
>pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 Back     alignment and structure
>pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 Back     alignment and structure
>pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 Back     alignment and structure
>pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 Back     alignment and structure
>pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 Back     alignment and structure
>pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 Back     alignment and structure
>pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 Back     alignment and structure
>pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 Back     alignment and structure
>pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 Back     alignment and structure
>pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 Back     alignment and structure
>pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 Back     alignment and structure
>pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 Back     alignment and structure
>pdb|1X6C|A Chain A, Solution Structures Of The Sh2 Domain Of Human Protein- Tyrosine Phosphatase Shp-1 Length = 118 Back     alignment and structure
>pdb|3GQI|B Chain B, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 226 Back     alignment and structure
>pdb|4FBN|A Chain A, Insights Into Structural Integration Of The Plcgamma Regulatory Region And Mechanism Of Autoinhibition And Activation Based On Key Roles Of Sh2 Domains Length = 246 Back     alignment and structure
>pdb|4EY0|A Chain A, Structure Of Tandem Sh2 Domains From Plcgamma1 Length = 246 Back     alignment and structure
>pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 Back     alignment and structure
>pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 Back     alignment and structure
>pdb|2CI8|A Chain A, Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomplexed Length = 99 Back     alignment and structure
>pdb|2CI8|A Chain A, Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomplexed Length = 99 Back     alignment and structure
>pdb|1Z3K|A Chain A, Structural Insight Into The Binding Diversity Between The Tyr-Phosphorylated Human Ephrinbs And Nck2 Sh2 Domain Length = 98 Back     alignment and structure
>pdb|1Z3K|A Chain A, Structural Insight Into The Binding Diversity Between The Tyr-Phosphorylated Human Ephrinbs And Nck2 Sh2 Domain Length = 98 Back     alignment and structure
>pdb|2CI9|A Chain A, Nck1 Sh2-Domain In Complex With A Dodecaphosphopeptide From Epec Protein Tir Length = 102 Back     alignment and structure
>pdb|2CI9|A Chain A, Nck1 Sh2-Domain In Complex With A Dodecaphosphopeptide From Epec Protein Tir Length = 102 Back     alignment and structure
>pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 Back     alignment and structure
>pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 Back     alignment and structure
>pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 Back     alignment and structure
>pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 Back     alignment and structure
>pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 Back     alignment and structure
>pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 Back     alignment and structure
>pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 Back     alignment and structure
>pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 Back     alignment and structure
>pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 Back     alignment and structure
>pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 Back     alignment and structure
>pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 Back     alignment and structure
>pdb|2CIA|A Chain A, Human Nck2 Sh2-Domain In Complex With A Decaphosphopeptide From Translocated Intimin Receptor (Tir) Of Epec Length = 102 Back     alignment and structure
>pdb|2CIA|A Chain A, Human Nck2 Sh2-Domain In Complex With A Decaphosphopeptide From Translocated Intimin Receptor (Tir) Of Epec Length = 102 Back     alignment and structure
>pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 Back     alignment and structure
>pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 Back     alignment and structure
>pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 Back     alignment and structure
>pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 Back     alignment and structure
>pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 Back     alignment and structure
>pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 Back     alignment and structure
>pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 Back     alignment and structure
>pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 Back     alignment and structure
>pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 Back     alignment and structure
>pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 Back     alignment and structure
>pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 Back     alignment and structure
>pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 Back     alignment and structure
>pdb|1A81|A Chain A, Crystal Structure Of The Tandem Sh2 Domain Of The Syk Kinase Bound To A Dually Tyrosine-Phosphorylated Itam Length = 254 Back     alignment and structure
>pdb|1X0N|A Chain A, Nmr Structure Of Growth Factor Receptor Binding Protein Sh2 Domain Complexed With The Inhibitor Length = 104 Back     alignment and structure
>pdb|1X0N|A Chain A, Nmr Structure Of Growth Factor Receptor Binding Protein Sh2 Domain Complexed With The Inhibitor Length = 104 Back     alignment and structure
>pdb|1JYQ|A Chain A, Xray Structure Of Grb2 Sh2 Domain Complexed With A Highly Affine Phospho Peptide Length = 96 Back     alignment and structure
>pdb|1JYQ|A Chain A, Xray Structure Of Grb2 Sh2 Domain Complexed With A Highly Affine Phospho Peptide Length = 96 Back     alignment and structure
>pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 Back     alignment and structure
>pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 Back     alignment and structure
>pdb|1CJ1|A Chain A, Growth Factor Receptor Binding Protein Sh2 Domain (Human) Complexed With A Phosphotyrosyl Derivative Length = 96 Back     alignment and structure
>pdb|1CJ1|A Chain A, Growth Factor Receptor Binding Protein Sh2 Domain (Human) Complexed With A Phosphotyrosyl Derivative Length = 96 Back     alignment and structure
>pdb|2AUG|A Chain A, Crystal Structure Of The Grb14 Sh2 Domain Length = 126 Back     alignment and structure
>pdb|2AUG|A Chain A, Crystal Structure Of The Grb14 Sh2 Domain Length = 126 Back     alignment and structure
>pdb|1GHU|A Chain A, Nmr Solution Structure Of Growth Factor Receptor-Bound Protein 2 (Grb2) Sh2 Domain, 24 Structures Length = 107 Back     alignment and structure
>pdb|1GHU|A Chain A, Nmr Solution Structure Of Growth Factor Receptor-Bound Protein 2 (Grb2) Sh2 Domain, 24 Structures Length = 107 Back     alignment and structure
>pdb|2FCI|A Chain A, Structural Basis For The Requirement Of Two Phosphotyrosines In Signaling Mediated By Syk Tyrosine Kinase Length = 105 Back     alignment and structure
>pdb|2FCI|A Chain A, Structural Basis For The Requirement Of Two Phosphotyrosines In Signaling Mediated By Syk Tyrosine Kinase Length = 105 Back     alignment and structure
>pdb|3EAZ|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), C122s Mutant Length = 106 Back     alignment and structure
>pdb|3EAC|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), Oxidized Form Length = 106 Back     alignment and structure
>pdb|1R1P|A Chain A, Structural Basis For Differential Recognition Of Tyrosine Phosphorylated Sites In The Linker For Activation Of T Cells (lat) By The Adaptor Protein Gads Length = 100 Back     alignment and structure
>pdb|1R1P|A Chain A, Structural Basis For Differential Recognition Of Tyrosine Phosphorylated Sites In The Linker For Activation Of T Cells (lat) By The Adaptor Protein Gads Length = 100 Back     alignment and structure
>pdb|2GSB|A Chain A, Solution Structure Of The Second Sh2 Domain Of Human Ras Gtpase-Activating Protein 1 Length = 119 Back     alignment and structure
>pdb|2GSB|A Chain A, Solution Structure Of The Second Sh2 Domain Of Human Ras Gtpase-Activating Protein 1 Length = 119 Back     alignment and structure
>pdb|2LCT|A Chain A, Solution Structure Of The Vav1 Sh2 Domain Complexed With A Syk-Derived Doubly Phosphorylated Peptide Length = 107 Back     alignment and structure
>pdb|2LCT|A Chain A, Solution Structure Of The Vav1 Sh2 Domain Complexed With A Syk-Derived Doubly Phosphorylated Peptide Length = 107 Back     alignment and structure
>pdb|2CRH|A Chain A, Solution Structure Of The Sh2 Domain Of Human Proto- Oncogene Protein Vav1 Length = 138 Back     alignment and structure
>pdb|2CRH|A Chain A, Solution Structure Of The Sh2 Domain Of Human Proto- Oncogene Protein Vav1 Length = 138 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|2LQN|A Chain A, Solution Structure Of Crkl Length = 303 Back     alignment and structure
>pdb|2LQW|A Chain A, Solution Structure Of Phosphorylated Crkl Length = 303 Back     alignment and structure
>pdb|2EO3|A Chain A, Solution Structure Of The Sh2 Domain From Human Crk-Like Protein Length = 111 Back     alignment and structure
>pdb|3S9K|A Chain A, Crystal Structure Of The Itk Sh2 Domain Length = 118 Back     alignment and structure
>pdb|3T04|A Chain A, Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN COMPLEX Length = 123 Back     alignment and structure
>pdb|3K2M|A Chain A, Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN COMPLEX Length = 112 Back     alignment and structure
>pdb|2ECD|A Chain A, Solution Structure Of The Human Abl2 Sh2 Domain Length = 119 Back     alignment and structure
>pdb|2ECD|A Chain A, Solution Structure Of The Human Abl2 Sh2 Domain Length = 119 Back     alignment and structure
>pdb|2ABL|A Chain A, Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine Kinase Length = 163 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 Back     alignment and structure
>pdb|1MW4|A Chain A, Solution Structure Of The Human Grb7-Sh2 Domain In Complex With A 10 Amino Acid Peptide Py1139 Length = 120 Back     alignment and structure
>pdb|3PQZ|A Chain A, Grb7 Sh2 With Peptide Length = 117 Back     alignment and structure
>pdb|1AB2|A Chain A, Three-Dimensional Solution Structure Of The Src Homology 2 Domain Of C-Abl Length = 109 Back     alignment and structure
>pdb|1AB2|A Chain A, Three-Dimensional Solution Structure Of The Src Homology 2 Domain Of C-Abl Length = 109 Back     alignment and structure
>pdb|2OZO|A Chain A, Autoinhibited Intact Human Zap-70 Length = 613 Back     alignment and structure
>pdb|2OQ1|A Chain A, Tandem Sh2 Domains Of Zap-70 With 19-Mer Zeta1 Peptide Length = 254 Back     alignment and structure
>pdb|2OQ1|A Chain A, Tandem Sh2 Domains Of Zap-70 With 19-Mer Zeta1 Peptide Length = 254 Back     alignment and structure
>pdb|1LUI|A Chain A, Nmr Structures Of Itk Sh2 Domain, Pro287cis Isoform, Ensemble Of 20 Low Energy Structures Length = 110 Back     alignment and structure
>pdb|2ETZ|A Chain A, The Nmr Minimized Average Structure Of The Itk Sh2 Domain Bound To A Phosphopeptide Length = 109 Back     alignment and structure
>pdb|1M61|A Chain A, Crystal Structure Of The Apo Sh2 Domains Of Zap-70 Length = 259 Back     alignment and structure
>pdb|2K79|B Chain B, Solution Structure Of The Binary Complex Between The Sh3 And Sh2 Domain Of Interleukin-2 Tyrosine Kinase Length = 110 Back     alignment and structure
>pdb|2DX0|A Chain A, Crystal Structure Of The N-Terminal Sh2 Domain Of Mouse Phospholipase C-Gamma 2 Length = 138 Back     alignment and structure
>pdb|2KK6|A Chain A, Solution Structure Of Sh2 Domain Of Proto-Oncogene Tyrosine- Protein Kinase Fer From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr3461d Length = 116 Back     alignment and structure
>pdb|1JWO|A Chain A, Crystal Structure Analysis Of The Sh2 Domain Of The Csk Homologous Kinase Chk Length = 97 Back     alignment and structure
>pdb|1JWO|A Chain A, Crystal Structure Analysis Of The Sh2 Domain Of The Csk Homologous Kinase Chk Length = 97 Back     alignment and structure
>pdb|2EOB|A Chain A, Solution Structure Of The Second Sh2 Domain From Rat Plc Gamma-2 Length = 124 Back     alignment and structure
>pdb|3US4|A Chain A, Crystal Structure Of A Sh2 Domain Of A Megakaryocyte-Associated Tyrosine Kinase (Matk) From Homo Sapiens At 1.50 A Resolution Length = 98 Back     alignment and structure
>pdb|3US4|A Chain A, Crystal Structure Of A Sh2 Domain Of A Megakaryocyte-Associated Tyrosine Kinase (Matk) From Homo Sapiens At 1.50 A Resolution Length = 98 Back     alignment and structure
>pdb|2HDV|A Chain A, Crystal Structure Of The Src Homology-2 Domain Of The Adapter Protein Sh2-B Length = 111 Back     alignment and structure
>pdb|3M7F|A Chain A, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 108 Back     alignment and structure
>pdb|3M7F|A Chain A, Crystal Structure Of The Nedd4 C2GRB10 SH2 COMPLEX Length = 108 Back     alignment and structure
>pdb|1NRV|A Chain A, Crystal Structure Of The Sh2 Domain Of Grb10 Length = 105 Back     alignment and structure
>pdb|1NRV|A Chain A, Crystal Structure Of The Sh2 Domain Of Grb10 Length = 105 Back     alignment and structure
>pdb|1CSY|A Chain A, Syk Tyrosine Kinase C-Terminal Sh2 Domain Complexed With A Phosphopeptidefrom The Gamma Chain Of The High Affinity Immunoglobin G Receptor, Nmr Length = 112 Back     alignment and structure
>pdb|1JU5|A Chain A, Ternary Complex Of An Crk Sh2 Domain, Crk-Derived Phophopeptide, And Abl Sh3 Domain By Nmr Spectroscopy Length = 109 Back     alignment and structure
>pdb|2EYZ|A Chain A, Ct10-Regulated Kinase Isoform Ii Length = 304 Back     alignment and structure
>pdb|2DVJ|A Chain A, Phosphorylated Crk-Ii Length = 230 Back     alignment and structure
>pdb|2EYY|A Chain A, Ct10-Regulated Kinase Isoform I Length = 204 Back     alignment and structure
>pdb|2EYV|A Chain A, Sh2 Domain Of Ct10-Regulated Kinase Length = 124 Back     alignment and structure
>pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 Back     alignment and structure
>pdb|1TCE|A Chain A, Solution Nmr Structure Of The Shc Sh2 Domain Complexed With A Tyrosine-Phosphorylated Peptide From The T-Cell Receptor, Minimized Average Structure Length = 107 Back     alignment and structure
>pdb|1MIL|A Chain A, Transforming Protein Length = 104 Back     alignment and structure
>pdb|2YSX|A Chain A, Solution Structure Of The Human Ship Sh2 Domain Length = 119 Back     alignment and structure
>pdb|1AOT|F Chain F, Nmr Structure Of The Fyn Sh2 Domain Complexed With A Phosphotyrosyl Peptide, Minimized Average Structure Length = 106 Back     alignment and structure
>pdb|2DLY|A Chain A, Solution Structure Of The Sh2 Domain Of Murine Fyn-Related Kinase Length = 121 Back     alignment and structure
>pdb|2DLY|A Chain A, Solution Structure Of The Sh2 Domain Of Murine Fyn-Related Kinase Length = 121 Back     alignment and structure
>pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 Back     alignment and structure
>pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 Back     alignment and structure
>pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 Back     alignment and structure
>pdb|1WQU|A Chain A, Solution Structure Of The Human Fes Sh2 Domain Length = 114 Back     alignment and structure
>pdb|4F59|A Chain A, Triple Mutant Src Sh2 Domain Length = 112 Back     alignment and structure
>pdb|2LNW|A Chain A, Identification And Structural Basis For A Novel Interaction Between Vav2 And Arap3 Length = 122 Back     alignment and structure
>pdb|2DLZ|A Chain A, Solution Structure Of The Sh2 Domain Of Human Protein Vav-2 Length = 118 Back     alignment and structure
>pdb|2DLZ|A Chain A, Solution Structure Of The Sh2 Domain Of Human Protein Vav-2 Length = 118 Back     alignment and structure
>pdb|1H9O|A Chain A, Phosphatidylinositol 3-Kinase, P85-Alpha Subunit: C-Terminal Sh2 Domain Complexed With A Tyr751 Phosphopeptide From The Pdgf Receptor, Crystal Structure At 1.79 A Length = 112 Back     alignment and structure
>pdb|1QAD|A Chain A, Crystal Structure Of The C-Terminal Sh2 Domain Of The P85 Alpha Regulatory Subunit Of Phosphoinositide 3-Kinase: An Sh2 Domain Mimicking Its Own Substrate Length = 111 Back     alignment and structure
>pdb|1BFI|A Chain A, Solution Structure Of The C-Terminal Sh2 Domain Of The P85alpha Regulatory Subunit Of Phosphoinositide 3-Kinase, Nmr, 30 Structures Length = 112 Back     alignment and structure
>pdb|1O41|A Chain A, Crystal Structure Of Sh2 In Complex With Ru78300. Length = 108 Back     alignment and structure
>pdb|1CWD|L Chain L, Human P56lck Tyrosine Kinase Complexed With Phosphopeptide Length = 98 Back     alignment and structure
>pdb|1SHD|A Chain A, Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein Interactions Length = 107 Back     alignment and structure
>pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 Back     alignment and structure
>pdb|2EKX|A Chain A, Solution Structure Of The Human Bmx Sh2 Domain Length = 110 Back     alignment and structure
>pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 Back     alignment and structure
>pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 Back     alignment and structure
>pdb|1O4C|A Chain A, Crystal Structure Of Sh2 In Complex With Phosphate. Length = 108 Back     alignment and structure
>pdb|2GE9|A Chain A, Solution Structures Of The Sh2 Domain Of Bruton's Tyrosine Kinase Length = 125 Back     alignment and structure
>pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 Back     alignment and structure
>pdb|2DM0|A Chain A, Solution Structure Of The Sh2 Domain Of Human Tyrosine- Protein Kinase Txk Length = 125 Back     alignment and structure
>pdb|1BLJ|A Chain A, Nmr Ensemble Of Blk Sh2 Domain, 20 Structures Length = 114 Back     alignment and structure
>pdb|1BLJ|A Chain A, Nmr Ensemble Of Blk Sh2 Domain, 20 Structures Length = 114 Back     alignment and structure
>pdb|1SKJ|A Chain A, Cocrystal Structure Of Urea-Substituted Phosphopeptide Complex Length = 113 Back     alignment and structure
>pdb|1IJR|A Chain A, Crystal Structure Of Lck Sh2 Complexed With Nonpeptide Phosphotyrosine Mimetic Length = 104 Back     alignment and structure
>pdb|1A1A|A Chain A, C-Src (Sh2 Domain With C188a Mutation) Complexed With Ace-Formyl Phosphotyr-Glu-(N,N-Dipentyl Amine) Length = 107 Back     alignment and structure
>pdb|1NZL|A Chain A, Crystal Structure Of Src Sh2 Domain Bound To Doubly Phosphorylated Peptide Pqpyepyipi Length = 103 Back     alignment and structure
>pdb|1P13|A Chain A, Crystal Structure Of The Src Sh2 Domain Complexed With Peptide (Sdpyanfk) Length = 102 Back     alignment and structure
>pdb|1FBZ|A Chain A, Structure-Based Design Of A Novel, Osteoclast-Selective, Nonpeptide Src Sh2 Inhibitor With In Vivo Anti-Resorptive Activity Length = 104 Back     alignment and structure
>pdb|1IS0|A Chain A, Crystal Structure Of A Complex Of The Src Sh2 Domain With Conformationally Constrained Peptide Inhibitor Length = 106 Back     alignment and structure
>pdb|1F1W|A Chain A, Src Sh2 Thref1trp Mutant Complexed With The Phosphopeptide S(Ptr)vnvqn Length = 104 Back     alignment and structure
>pdb|1SHA|A Chain A, Crystal Structure Of The Phosphotyrosine Recognition Domain Sh2 Of V-Src Complexed With Tyrosine-Phosphorylated Peptides Length = 104 Back     alignment and structure
>pdb|1BKL|A Chain A, Self-Associated Apo Src Sh2 Domain Length = 113 Back     alignment and structure
>pdb|1BKM|A Chain A, Cocrystal Structure Of D-Amino Acid Substituted Phosphopeptide Complex Length = 113 Back     alignment and structure
>pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 Back     alignment and structure
>pdb|1LCJ|A Chain A, Sh2 (Src Homology-2) Domain Of Human P56-Lck Tyrosine Kinase Complexed With The 11 Residue Phosphotyrosyl Peptide Epqpyeeipiyl Length = 109 Back     alignment and structure
>pdb|3NHN|A Chain A, Crystal Structure Of The Src-Family Kinase Hck Sh3-Sh2-Linker Regulatory Region Length = 193 Back     alignment and structure
>pdb|1BHF|A Chain A, P56lck Sh2 Domain Inhibitor Complex Length = 108 Back     alignment and structure
>pdb|1LKK|A Chain A, Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex With The Phosphotyrosyl Peptide Ac-Ptyr-Glu-Glu-Ile (Pyeei Peptide) Length = 105 Back     alignment and structure
>pdb|1LKL|A Chain A, Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex With The Phosphotyrosyl Peptide Ac-Ptyr-Glu-Glu-Gly (Pyeeg Peptide) Length = 104 Back     alignment and structure
>pdb|1BHH|B Chain B, Free P56lck Sh2 Domain Length = 103 Back     alignment and structure
>pdb|2CS0|A Chain A, Solution Structure Of The Sh2 Domain Of Human Hsh2d Protein Length = 119 Back     alignment and structure
>pdb|1QCF|A Chain A, Crystal Structure Of Hck In Complex With A Src Family- Selective Tyrosine Kinase Inhibitor Length = 454 Back     alignment and structure
>pdb|1AD5|A Chain A, Src Family Kinase Hck-Amp-Pnp Complex Length = 438 Back     alignment and structure
>pdb|1LCK|A Chain A, Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine Kinase Complexed With The 10 Residue Synthetic Phosphotyrosyl Peptide Tegqpyqpqpa Length = 175 Back     alignment and structure
>pdb|4D8K|A Chain A, Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphocyte-Specific Protein Tyrosine Kinase (Lck) From Homo Sapiens At 2.36 A Resolution Length = 175 Back     alignment and structure
>pdb|1X27|A Chain A, Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding Site Of P130cas Length = 167 Back     alignment and structure
>pdb|1KC2|A Chain A, Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c8ala, Aspcd2ala) Mutant Of The Src Sh2 Domain Bound To The Pqpyeeipi Peptide Length = 103 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query451
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 0.0
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 0.0
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 1e-10
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 0.0
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 8e-10
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 1e-110
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 1e-110
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 1e-104
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 1e-104
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 1e-104
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 1e-103
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 1e-103
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 1e-102
3i36_A 342 Vascular protein tyrosine phosphatase 1; PTP, hydr 1e-102
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 1e-102
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 1e-101
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 1e-101
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 1e-101
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 1e-100
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 7e-80
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 1e-99
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; 2e-99
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 8e-99
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 1e-98
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 7e-98
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 1e-75
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 9e-98
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 4e-96
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 6e-96
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 6e-82
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 1e-95
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 3e-95
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 3e-80
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 1e-94
1l8k_A 314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 7e-94
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 7e-92
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 6e-91
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 1e-78
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 6e-68
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 1e-64
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 2e-27
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 2e-26
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 2e-63
3gqi_B226 Phospholipase C-gamma-1; phosphorylated kinase, PY 3e-27
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 3e-63
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 2e-45
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 5e-37
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 5e-40
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 1e-34
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 2e-39
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 2e-35
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 4e-39
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 3e-35
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-38
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 8e-21
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 1e-15
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 1e-38
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 1e-33
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 2e-38
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 2e-33
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 2e-38
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 1e-34
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 6e-38
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 1e-34
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 2e-37
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 1e-33
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 4e-37
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 1e-33
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 5e-37
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 2e-36
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 4e-36
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 9e-33
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 1e-35
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 2e-34
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 2e-35
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 2e-30
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 4e-35
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 2e-30
2dly_A121 FYN-related kinase; BRK family kinase, structural 5e-35
2dly_A121 FYN-related kinase; BRK family kinase, structural 2e-30
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 1e-34
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 2e-26
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 8e-18
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 8e-15
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 1e-34
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 2e-28
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 2e-34
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 4e-31
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 2e-34
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 9e-30
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 3e-34
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 4e-28
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 4e-34
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 2e-31
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 6e-34
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 2e-31
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 8e-34
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 2e-29
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 9e-34
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 1e-30
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 1e-33
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 4e-33
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 1e-33
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 5e-32
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 3e-33
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 2e-30
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 3e-33
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 6e-31
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 4e-33
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 3e-26
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 1e-32
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 1e-29
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 1e-32
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 5e-29
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 3e-32
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 1e-28
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 5e-32
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 2e-26
2aug_A126 Growth factor receptor-bound protein 14; phosphory 5e-32
2aug_A126 Growth factor receptor-bound protein 14; phosphory 9e-32
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 2e-31
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 2e-27
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 3e-31
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 9e-31
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 3e-31
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 2e-27
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 1e-29
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 1e-29
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 6e-29
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 9e-29
2vif_A141 Suppressor of cytokine signalling 6; growth regula 6e-28
2vif_A141 Suppressor of cytokine signalling 6; growth regula 2e-26
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 1e-27
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 3e-25
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 3e-27
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 6e-26
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 1e-26
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 1e-24
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 3e-26
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 1e-24
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 4e-26
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 1e-22
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 2e-25
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 1e-23
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 7e-24
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 1e-18
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 4e-23
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 2e-22
3maz_A125 Signal-transducing adaptor protein 1; modular doma 1e-22
3maz_A125 Signal-transducing adaptor protein 1; modular doma 2e-19
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-21
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 4e-21
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 3e-21
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 6e-21
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 1e-20
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 2e-19
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 6e-20
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 2e-18
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 8e-20
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 2e-18
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-19
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 4e-17
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 2e-18
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 6e-18
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 2e-18
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 7e-08
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 6e-18
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 2e-16
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 1e-16
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 5e-10
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 8e-16
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 1e-13
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 7e-15
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 2e-14
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 1e-12
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 4e-09
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 9e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 6e-09
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 3e-08
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 4e-08
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 1e-06
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 Back     alignment and structure
 Score =  636 bits (1642), Expect = 0.0
 Identities = 298/470 (63%), Positives = 348/470 (74%), Gaps = 47/470 (10%)

Query: 1   MSSRRWFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTG 60
           M SRRWFHP+I+GVEAE LLL RG DGSFL RPS+SNPGD TLSVR NG VTHIKIQNTG
Sbjct: 1   MKSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDLTLSVRRNGAVTHIKIQNTG 60

Query: 61  DCYDLYGGEKFATLSELVQFYMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGK 120
           D YDLYGGEKFATL+ELVQ+YME+ GQLK++N +VIELKYPL+CADPT+ERWFHG LSG 
Sbjct: 61  DYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSG- 119

Query: 121 EAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDD-- 178
                                 KEAE+L+ +KGK+GSFLVRESQS PGDFVLSVRT D  
Sbjct: 120 ----------------------KEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDK 157

Query: 179 --------KVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFN 230
                   KVTHVMIRCQ  KYDVGGGE+FDSLT L+EHYK+NPMVET GTV+ LKQP N
Sbjct: 158 GESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLN 217

Query: 231 ATRITVSNIHDRVTELQKE----NSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKN 286
            TRI  + I  RV EL K     +  K GFWEEFE+LQQQE + L++R+EGQ+ +N+NKN
Sbjct: 218 TTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKN 277

Query: 287 RYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSE--------DGGKSYIATQGCLPST 338
           RYKNILPFDHTRV L D D + P ++YINAN I  E           KSYIATQGCL +T
Sbjct: 278 RYKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNT 337

Query: 339 MNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYI 398
           +NDFW MV+QEN RVIVMTTKE+ERGK+KC KYWPD++  K YG + V N+ ES   DY 
Sbjct: 338 VNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYT 397

Query: 399 LREFLVSKGS--ESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQD 446
           LRE  +SK     + R ++ YHF+ WPDHGVPSDPG VL+FL EV+ +Q+
Sbjct: 398 LRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQE 447
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Length = 178 Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Length = 178 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Length = 463 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query451
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 100.0
3ps5_A 595 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 100.0
3s3e_A307 Tyrosine-protein phosphatase 10D; differentiation, 100.0
4ge6_A314 Tyrosine-protein phosphatase non-receptor type 9; 100.0
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; 100.0
4grz_A288 Tyrosine-protein phosphatase non-receptor type 6; 100.0
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; p 100.0
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; h 100.0
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; prot 100.0
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine 100.0
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; 100.0
3i36_A 342 Vascular protein tyrosine phosphatase 1; PTP, hydr 100.0
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; 100.0
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; 100.0
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; 100.0
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; 100.0
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
2i1y_A301 Receptor-type tyrosine-protein phosphatase; recept 100.0
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; 100.0
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein 100.0
1l8k_A 314 T-cell protein-tyrosine phosphatase; hydrolase; 2. 100.0
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, re 100.0
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; 100.0
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, 100.0
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14 100.0
4i8n_A 354 Tyrosine-protein phosphatase non-receptor type 1; 100.0
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; 100.0
3m4u_A306 Tyrosine specific protein phosphatase, putative; p 100.0
4az1_A302 Tyrosine specific protein phosphatase; hydrolase, 100.0
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 100.0
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13 100.0
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G VA 100.0
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosin 100.0
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, 100.0
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilo; 100.0
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolas 100.0
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence facto 100.0
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 100.0
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 100.0
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 100.0
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 100.0
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 100.0
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 99.97
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 99.92
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 99.92
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 99.91
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 99.91
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 99.91
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 99.9
2dly_A121 FYN-related kinase; BRK family kinase, structural 99.9
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 99.9
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 99.9
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 99.9
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 99.9
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 99.89
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 99.89
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 99.89
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 99.89
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 99.89
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.89
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 99.89
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 99.89
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 99.89
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 99.89
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 99.89
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 99.89
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 99.89
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 99.89
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 99.89
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 99.88
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 99.88
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.88
3maz_A125 Signal-transducing adaptor protein 1; modular doma 99.88
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 99.88
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 99.88
2aug_A126 Growth factor receptor-bound protein 14; phosphory 99.88
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 99.88
2vif_A141 Suppressor of cytokine signalling 6; growth regula 99.88
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 99.88
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 99.87
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 99.87
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 99.87
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 99.87
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 99.87
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 99.87
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.86
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 99.86
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 99.86
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 99.86
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 99.86
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 99.85
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 99.83
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.83
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 99.82
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 99.81
2oq1_A254 Tyrosine-protein kinase ZAP-70; tandem SH2 domains 99.81
1a81_A254 SYK kinase; complex (transferase-peptide), SYK, ki 99.8
2cia_A102 Cytoplasmic protein NCK2; SH2-domain, SH3 domain, 99.8
2lnw_A122 VAV-2, guanine nucleotide exchange factor VAV2; si 99.78
3tkz_A109 Tyrosine-protein phosphatase non-receptor type 11; 99.78
4fbn_A246 1-phosphatidylinositol 4,5-bisphosphate phosphodi 99.78
3us4_A98 Megakaryocyte-associated tyrosine-protein kinase; 99.77
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.77
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.77
2dlz_A118 Protein VAV-2; RHO family guanine nucleotide excha 99.77
2dly_A121 FYN-related kinase; BRK family kinase, structural 99.76
3eaz_A106 Tyrosine-protein kinase CSK; SH2, disulfide, oxidi 99.76
1lkk_A105 Human P56 tyrosine kinase; complex (tyrosine kinas 99.76
1d4t_A104 T cell signal transduction molecule SAP; SH2 domai 99.76
1rja_A100 Tyrosine-protein kinase 6; human protein tyrosine 99.75
2dx0_A138 Phospholipase C, gamma 2; phosphoric diester hydro 99.75
2eob_A124 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.75
1blj_A114 P55 BLK protein tyrosine kinase; signal transducti 99.74
3maz_A125 Signal-transducing adaptor protein 1; modular doma 99.74
2iug_A120 Phosphatidylinositol 3-kinase regulatory alpha sub 99.74
2ysx_A119 Signaling inositol polyphosphate phosphatase SHIP 99.74
2kk6_A116 Proto-oncogene tyrosine-protein kinase FER; method 99.74
1i3z_A103 EWS/FLI1 activated transcript 2; SH2 domain phosph 99.73
1aot_F106 FYN protein-tyrosine kinase; SH2 domain, signal tr 99.73
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.73
2crh_A138 VAV proto-oncogene; oncoprotein, structural genomi 99.73
1jyr_A96 Growth factor receptor-bound protein 2; receptor b 99.73
1nrv_A105 Growth factor receptor-bound protein 10; dimer, si 99.73
1h9o_A112 Phosphatidylinositol 3-kinase; transferase/recepto 99.73
3pqz_A117 Growth factor receptor-bound protein 7; SH2, binds 99.73
3ov1_A117 Growth factor receptor-bound protein 2; GRB2 SH2 d 99.73
3k2m_A112 Proto-oncogene tyrosine-protein kinase ABL1; engin 99.73
1ka6_A128 SH2 domain protein 1A; SH2 domain, protein-peptide 99.72
2aug_A126 Growth factor receptor-bound protein 14; phosphory 99.72
2ekx_A110 Cytoplasmic tyrosine-protein kinase BMX; SH2 domai 99.72
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.72
2ecd_A119 Tyrosine-protein kinase ABL2; SH2 domain, phosphot 99.72
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.56
1mil_A104 SHC adaptor protein; SH2 domain, phosphorylation, 99.72
2eo3_A111 CRK-like protein; phosphorylation, repeat, SH2 dom 99.72
2gsb_A119 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.72
2ge9_A125 Tyrosine-protein kinase BTK; SH2 domain, structure 99.71
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.71
2hdv_A111 SH2-B PH domain containing signaling mediator 1 ga 99.71
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.71
3s9k_A118 Tyrosine-protein kinase ITK/TSK; proline isomeriza 99.7
2el8_A118 Signal-transducing adaptor protein 2; SH2 domain, 99.7
1r1p_A100 GRB2-related adaptor protein 2; SH2, GADS, phospho 99.7
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.7
2kno_A131 Tensin-like C1 domain-containing phosphatase; SH2 99.69
2cs0_A119 Hematopoietic SH2 domain containing; ALX, FLJ14886 99.69
2c9w_A169 Suppressor of cytokine signaling 2; growth regulat 99.69
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.69
2eo6_A141 B-cell linker protein; SH2, cytoplasmic adapter pr 99.69
1wqu_A114 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.68
2hmh_A152 Suppressor of cytokine signaling 3; SOCS3, GP130, 99.68
2dm0_A125 Tyrosine-protein kinase TXK; TEC family kinase, st 99.68
3ps5_A595 Tyrosine-protein phosphatase non-receptor type 6; 99.68
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.68
2bbu_A164 Suppressor of cytokine signaling 3; SH2 domain, ex 99.67
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.67
1ju5_A109 CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid 99.67
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin 99.66
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.66
2vif_A141 Suppressor of cytokine signalling 6; growth regula 99.66
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 99.65
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.65
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.64
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; 99.63
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 99.62
2izv_A187 Suppressor of cytokine signaling 4; signal transdu 99.6
2y3a_B302 Phosphatidylinositol 3-kinase regulatory subunit; 99.59
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 99.55
2cr4_A126 3BP-2, SH3 domain-binding protein 2; structural ge 99.55
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.54
3hhm_B373 NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil 99.54
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.52
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.49
3s4o_A167 Protein tyrosine phosphatase-like protein; structu 99.48
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.44
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 99.13
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.38
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.2
3cxl_A463 N-chimerin; SH2, RHO-GAP, structural genomics cons 99.17
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.16
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.15
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.12
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.09
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.07
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.05
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; p 98.85
3rz2_A189 Protein tyrosine phosphatase type IVA 1; tyrosine 98.81
3psi_A1219 Transcription elongation factor SPT6; nucleus; 3.3 98.68
2xp1_A178 SPT6; transcription, IWS1, histone chaperone, mRNA 98.64
1uur_A473 Stata protein, STAT protein; transcription activat 98.28
1y1u_A585 Signal transducer and activator of transcription; 97.3
3or8_A197 Transcription elongation factor SPT6; SH2, CTD bin 97.27
1yvl_A683 Signal transducer and activator of transcription 1 97.24
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 97.06
3op0_A323 Signal transduction protein CBL-C; structural geno 96.93
1bf5_A575 Signal transducer and activator of transcription 1 96.82
1uur_A473 Stata protein, STAT protein; transcription activat 96.79
1bg1_A596 Protein (transcription factor STAT3B); protein-DNA 96.79
2img_A151 Dual specificity protein phosphatase 23; DUSP23, V 96.33
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 93.99
1y1u_A585 Signal transducer and activator of transcription; 93.49
3op0_A323 Signal transduction protein CBL-C; structural geno 92.72
1bg1_A596 Protein (transcription factor STAT3B); protein-DNA 92.65
1yvl_A683 Signal transducer and activator of transcription 1 92.06
1bf5_A575 Signal transducer and activator of transcription 1 89.2
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sa 86.76
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
Probab=100.00  E-value=2e-95  Score=746.53  Aligned_cols=424  Identities=70%  Similarity=1.151  Sum_probs=380.7

Q ss_pred             CCCCCccCCCCCHHHHHHHHhcCCCCCeEEEeecCCCCCceEEEEEECCeEEEEEEEeeCCeEEecCCcccCCHHHHHHH
Q psy8516           1 MSSRRWFHPSISGVEAEVLLLERGYDGSFLVRPSRSNPGDFTLSVRLNGEVTHIKIQNTGDCYDLYGGEKFATLSELVQF   80 (451)
Q Consensus         1 l~~~~wy~g~isr~~Ae~lL~~~~~~G~flvR~s~~~~~~~~ls~~~~~~~~h~~I~~~~~~~~~~~~~~f~sl~~Lv~~   80 (451)
                      |+.++||||.|+|++||++|...+.+|+||||+|++.+|.|+||++.++.++||+|...++.|.+.+...|+||.+||+|
T Consensus         1 l~~~~Wyhg~i~r~~Ae~lL~~~~~~G~FLvR~S~~~~g~~~Lsv~~~~~v~H~~I~~~~~~~~l~~~~~F~sl~eLv~~   80 (525)
T 2shp_A            1 MKSRRWFHPNITGVEAENLLLTRGVDGSFLARPSKSNPGDLTLSVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQY   80 (525)
T ss_dssp             -CCSTTBCSSCCHHHHHHHHHHHCCTTEEEEEECSSSTTCEEEEEEETTEEEEEEEECSSSCEEETTSCEESSHHHHHHH
T ss_pred             CCCCCcccCCCCHHHHHHHHHhCCCCCcEEeeccCCCCCcEEEEEEECCEEEEEEEEecCCeEEECCCCeECCHHHHHHH
Confidence            67899999999999999999876559999999999999999999999999999999888888888888999999999999


Q ss_pred             HHhccccccccccceeeecCCCCCCCCCccccccCCcchHHHHHHHHHcCCCCCcccccCchHHHHHHHHhcCCCceEEE
Q psy8516          81 YMENQGQLKKRNQEVIELKYPLSCADPTTERWFHGQLSGKEAEQLILQKGKNGSFLVRESQSKEAEQLILQKGKNGSFLV  160 (451)
Q Consensus        81 y~~~~~~l~~~~~~~i~L~~Pv~~~~~~~~~w~~~~~~~~~ae~~l~~~~~~g~fg~~~~~~~~a~~~l~~~~~~G~flv  160 (451)
                      |+.++.++....+..+.|+.|+.+.+|..++||||.|+|.+||.+|...+                       ++|+|||
T Consensus        81 y~~~~~~l~~~~g~~i~L~~Pv~~~dp~~~~w~~g~~~r~~Ae~lL~~~~-----------------------~~G~FLV  137 (525)
T 2shp_A           81 YMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGKEAEKLLTEKG-----------------------KHGSFLV  137 (525)
T ss_dssp             HHTCTTCSBSSSSCBCCCCEECCCCCCTTCTTBCCSCCHHHHHHHHHHTC-----------------------CTTEEEE
T ss_pred             HHhCCccccccccccccccccccccccccceeecccCCHHHHHHHHhccC-----------------------CCceEEE
Confidence            99999888777777889999999999999999999999999999998875                       5999999


Q ss_pred             ecCCCCCCCeEEEEEeCC----------eeeeEEEEEeCCeEEecCCcccccHHHHHHhhhcCCcccccceeEEeccccc
Q psy8516         161 RESQSKPGDFVLSVRTDD----------KVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFN  230 (451)
Q Consensus       161 R~s~~~~~~~~ls~~~~~----------~v~h~~I~~~~~~~~~~~~~~F~sl~~Li~~y~~~~lv~~~g~~~~L~~p~~  230 (451)
                      |+|++.+|.|+||++..+          .|+|++|.+..|+|++++...|+||.+||+||+.++++...|..+.|+.|++
T Consensus       138 R~S~~~~g~y~LSv~~~~~~~~~~~~~~~v~H~~I~~~~g~~~l~~~~~F~sL~eLV~~y~~~~l~~~~g~~~~L~~P~~  217 (525)
T 2shp_A          138 RESQSHPGDFVLSVRTGDDKGESNDGKSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLN  217 (525)
T ss_dssp             EECSSSTTCEEEEEEECC-----CCCCCEEEEEEEEEETTEEESSSSCCBSSHHHHHHHHHHSCCBCTTSCBCCCCEECC
T ss_pred             EecCCCCCCEEEEEEECCccccccccccceEEEEEEecCCeEEECCCceeCcHHHHHHhhhccCccccCCeEEEeecccc
Confidence            999999999999999987          8999999999999999888899999999999999999998899999999999


Q ss_pred             cccccccchhhhHHHhhhccC----CCccchHHHHhhhcccccccccccccccccCCCCCCCCCCCCCCCCceEecCCCC
Q psy8516         231 ATRITVSNIHDRVTELQKENS----SKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDE  306 (451)
Q Consensus       231 ~t~i~~~~l~~~v~~l~~~~~----~~~~~~~ef~~l~~~~~~~~~~~~~~~~~~n~~knR~~~i~p~d~~rv~l~~~~~  306 (451)
                      .+.+++.++..++++|.+.++    +..+|++||+.|........+++..+..++|+.||||.||+|||+|||+|.+.++
T Consensus       218 ~t~i~a~~l~~~v~~l~~~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~~~n~~kNRy~~i~p~d~sRV~L~~~~~  297 (525)
T 2shp_A          218 TTRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDP  297 (525)
T ss_dssp             CSCEEGGGHHHHHHHHHC----------CHHHHHHHHHGGGGGGCCCCHHHHSGGGGGGSSSTTCCCCTTTEEECCC---
T ss_pred             ccccchhhHHHHHHHHhhcccccccchhhHHHHHHHHhcccccccchhhhccChhhhhcCCCCCcCCCcCceeecccCCC
Confidence            999999999999999987643    5789999999998876555555567889999999999999999999999987654


Q ss_pred             CCCCCCceeeEEeecCCC--------CceEEEeCCCCcccHHHHHhHhhcccceEEEeeccccccCcccceeecCCCCCc
Q psy8516         307 DVPGAEYINANYIQSEDG--------GKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQS  378 (451)
Q Consensus       307 ~~~~~~yinAs~v~~~~~--------~~~~I~tQ~P~~~t~~dFW~mv~~~~~~~Iv~l~~~~e~~~~~c~~YwP~~~~~  378 (451)
                      +.+++||||||||+++..        .++|||||||+++|++|||+||||++|.+|||||...|.++.+|.+|||.++++
T Consensus       298 ~~~~~dYINAn~i~~~~~~~g~~~~~~~~yIatQgPl~~T~~dFW~Mvwe~~~~~IVmlt~~~E~g~~kc~~YwP~~~~~  377 (525)
T 2shp_A          298 NEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYAL  377 (525)
T ss_dssp             ----CCEEEEEEECC-----------CCCEEEECCCCTTTHHHHHHHHHHHTCCEEEECSCSEETTEESCCCCSCCTTCE
T ss_pred             CCCCCCeEEeeeeccccccccccccccceeEEecCCChhhHHHHHHHHhccCCCEEEEcccceECCcccCccccCCCCCc
Confidence            445689999999999843        689999999999999999999999999999999999999999999999998778


Q ss_pred             eEEeeEEEEEeeeeeecCEEEEEEEEEeCC--CCCEEEEEEeeCCCCCCCCCCChHHHHHHHHHHHhhhcc
Q psy8516         379 KTYGAVCVNNMYESVTTDYILREFLVSKGS--ESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDI  447 (451)
Q Consensus       379 ~~~~~~~v~~~~~~~~~~~~~~~l~v~~~~--~~~~~v~~~~~~~Wp~~~~P~~~~~~l~~~~~v~~~~~~  447 (451)
                      ..||.|+|++.++....+|+.|+|.|++.+  +++|+|+||||++|||+|+|+++..+++|++.|++.++.
T Consensus       378 ~~~g~~~V~~~~~~~~~~~~~r~l~v~~~~~~~~~r~V~h~~y~~WPD~gvP~~~~~~l~~~~~v~~~~~~  448 (525)
T 2shp_A          378 KEYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQES  448 (525)
T ss_dssp             EEETTEEEEEEEEEECSSEEEEEEEEEETTEEEEEEEEEEEEECCCCSSSCCSCHHHHHHHHHHHHHHHHH
T ss_pred             eEEcCEEEEEEEEEecCCEEEEEEEEEEcCCCCccEEEEEEEecCCCCCCcccChHHHHHHHHHHHHHHhc
Confidence            899999999999999999999999999864  578999999999999999999999999999999987643
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Back     alignment and structure
>4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Back     alignment and structure
>4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Back     alignment and structure
>1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Back     alignment and structure
>2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Back     alignment and structure
>2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A Back     alignment and structure
>3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* Back     alignment and structure
>3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Back     alignment and structure
>1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Back     alignment and structure
>1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Back     alignment and structure
>1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Back     alignment and structure
>2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Back     alignment and structure
>1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Back     alignment and structure
>3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Back     alignment and structure
>2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Back     alignment and structure
>2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Back     alignment and structure
>1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Back     alignment and structure
>1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Back     alignment and structure
>1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Back     alignment and structure
>1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Back     alignment and structure
>3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Back     alignment and structure
>3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Back     alignment and structure
>3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Back     alignment and structure
>1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Back     alignment and structure
>2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Back     alignment and structure
>2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Back     alignment and structure
>2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Back     alignment and structure
>2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Back     alignment and structure
>2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Back     alignment and structure
>1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Back     alignment and structure
>2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Back     alignment and structure
>2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Back     alignment and structure
>2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A Back     alignment and structure
>3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Back     alignment and structure
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Back     alignment and structure
>3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Back     alignment and structure
>1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Back     alignment and structure
>1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} Back     alignment and structure
>3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} Back     alignment and structure
>1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A Back     alignment and structure
>1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} Back     alignment and structure
>1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 451
d2shpa1307 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( 6e-70
d1fpra_284 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-62
d1lara1 317 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie 3e-57
d2f71a1297 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho 3e-57
d1rpma_278 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 2e-55
d1l8ka_273 c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa 3e-53
d1yfoa_288 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 2e-52
d1p15a_245 c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { 4e-52
d1lyva_283 c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c 2e-51
d1g4us2243 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca 3e-50
d1lara2249 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie 3e-50
d1jlna_297 c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus 8e-50
d1wcha_308 c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re 4e-49
d2shpa2109 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma 9e-39
d2shpa2109 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma 2e-26
d2shpa3108 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu 7e-29
d2shpa3108 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu 4e-26
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 3e-25
d1jyra_96 d.93.1.1 (A:) Growth factor receptor-bound protein 4e-24
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 6e-25
d1r1qa_97 d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA 2e-24
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 1e-24
d1mila_104 d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap 1e-22
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 3e-24
d1jwoa_97 d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho 2e-23
d2qmsa1113 d.93.1.1 (A:420-532) Growth factor receptor-bound 4e-24
d2qmsa1113 d.93.1.1 (A:420-532) Growth factor receptor-bound 6e-24
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 9e-24
d1nrva_105 d.93.1.1 (A:) Growth factor receptor-bound protein 2e-23
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 3e-23
d2fcia1105 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B 2e-20
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 5e-23
d1fu6a_111 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 3e-21
d1qada_107 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 6e-23
d1qada_107 d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a 1e-20
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 8e-23
d1k9aa2101 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( 1e-21
d2oq1a1130 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 1e-22
d2oq1a1130 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 4e-21
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho 2e-22
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 3e-22
d1a81a1129 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom 1e-19
d1d4ta_104 d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap 4e-22
d1d4ta_104 d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap 3e-20
d1i3za_103 d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat 5e-22
d1i3za_103 d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat 1e-20
d1rpya_86 d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor 9e-22
d1rpya_86 d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor 2e-21
d2eyva1109 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo 3e-21
d2eyva1109 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo 7e-21
d1lkka_105 d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo 3e-21
d1lkka_105 d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo 8e-21
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 8e-21
d1rjaa_100 d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu 1e-19
d1o48a_106 d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s 1e-20
d1o48a_106 d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s 2e-19
d1blja_114 d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou 2e-20
d1blja_114 d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou 1e-18
d1qcfa2103 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H 3e-20
d1qcfa2103 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H 2e-19
d1opka2101 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M 3e-20
d1opka2101 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M 1e-19
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 5e-20
d1uura3131 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium 8e-14
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 5e-20
d2oq1a2124 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 6e-20
d2c9wa2103 d.93.1.1 (A:32-134) Suppressor of cytokine signali 1e-19
d2c9wa2103 d.93.1.1 (A:32-134) Suppressor of cytokine signali 2e-18
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 2e-19
d2izva2112 d.93.1.1 (A:274-385) Suppressor of cytokine signal 3e-19
d1g83a2104 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H 2e-19
d1g83a2104 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H 4e-19
d1luia_108 d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou 2e-18
d1luia_108 d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou 3e-18
d1xa6a2141 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom 3e-18
d1xa6a2141 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom 7e-16
d1a81a2125 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H 3e-18
d1a81a2125 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H 1e-17
d2cs0a1106 d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai 2e-17
d2cs0a1106 d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai 4e-15
d1bg1a3141 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) 1e-15
d1bg1a3141 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) 2e-13
d1rxda_152 c.45.1.1 (A:) Protein tyrosine phosphatase type IV 2e-08
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Human (Homo sapiens), shp-2 [TaxId: 9606]

 Score =  222 bits (566), Expect = 6e-70
 Identities = 131/229 (57%), Positives = 162/229 (70%), Gaps = 14/229 (6%)

Query: 232 TRITVSNIHDRVTELQK----ENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNR 287
           TRI  + I  RV EL K     +  K GFWEEFE+LQQQE + L++R+EGQ+ +N+NKNR
Sbjct: 1   TRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNR 60

Query: 288 YKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGG--------KSYIATQGCLPSTM 339
           YKNILPFDHTRV L D D + P ++YINAN I  E           KSYIATQGCL +T+
Sbjct: 61  YKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTV 120

Query: 340 NDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYIL 399
           NDFW MV+QEN RVIVMTTKE+ERGK+KC KYWPD++  K YG + V N+ ES   DY L
Sbjct: 121 NDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTL 180

Query: 400 REFLVSK--GSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQD 446
           RE  +SK     + R ++ YHF+ WPDHGVPSDPG VL+FL EV+ +Q+
Sbjct: 181 RELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQE 229
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query451
d2shpa1307 Tyrosine phosphatase {Human (Homo sapiens), shp-2 100.0
d1fpra_284 Tyrosine phosphatase {Human (Homo sapiens), shp-1 100.0
d1yfoa_288 Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 100.0
d1lara1 317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1rpma_278 Tyrosine phosphatase {Human (Homo sapiens), mu [Ta 100.0
d1wcha_308 Tyrosine-protein phosphatase, non-receptor type 13 100.0
d1l8ka_273 Tyrosine phosphatase {Human (Homo sapiens), T-cell 100.0
d2f71a1297 Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta 100.0
d1p15a_245 Protein-tyrosine phosphatase alpha {Mouse (Mus mus 100.0
d1jlna_297 Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl 100.0
d1lara2249 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1lyva_283 Protein-tyrosine phosphatase YopH, catalytic domai 100.0
d1g4us2243 SptP tyrosine phosphatase, catalytic domain {Salmo 100.0
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.94
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 99.93
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.93
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 99.92
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.92
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 99.92
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.91
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.91
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 99.9
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 99.9
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 99.9
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 99.9
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 99.9
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 99.89
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.89
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.89
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 99.89
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 99.89
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 99.88
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 99.88
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 99.88
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.88
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 99.88
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.88
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 99.87
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 99.87
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.86
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 99.86
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.86
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 99.84
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 99.83
d1rjaa_100 Tyrosine-protein kinase 6 (Breast tumor kinase, Br 99.81
d2shpa2109 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.8
d1jwoa_97 Csk homologous kinase Chk {Human (Homo sapiens) [T 99.8
d1k9aa2101 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.79
d1a81a1129 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.78
d1jyra_96 Growth factor receptor-bound protein 2 (GRB2) {Hum 99.77
d1r1qa_97 GRB2-related adaptor protein 2 (MONA, GRID) {Mouse 99.77
d1nrva_105 Growth factor receptor-bound protein 10, GRB10 {Hu 99.76
d1opka2101 Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 99.76
d2fcia1105 Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 99.76
d1lkka_105 p56-lck tyrosine kinase {Human (Homo sapiens) [Tax 99.76
d2oq1a2124 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.76
d1qcfa2103 Hemopoetic cell kinase Hck {Human (Homo sapiens) [ 99.76
d2oq1a1130 Tyrosine-protein kinase zap-70 {Human (Homo sapien 99.75
d2shpa3108 Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T 99.75
d1i3za_103 Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus 99.75
d1mila_104 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.75
d1o48a_106 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.74
d1d4ta_104 The Xlp protein Sap {Human (Homo sapiens) [TaxId: 99.74
d1blja_114 P55 Blk protein tyrosine kinase {Mouse (Mus muscul 99.73
d1a81a2125 Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 99.73
d2qmsa1113 Growth factor receptor-bound protein 7 {Human (Hom 99.73
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 99.73
d1g83a2104 Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 99.73
d1luia_108 Itk/tsk protein tyrosine kinase {Mouse (Mus muscul 99.7
d2izva2112 Suppressor of cytokine signaling 4, SOCS-4 {Human 99.7
d1qada_107 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.69
d1rpya_86 Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI 99.68
d2eyva1109 Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 99.65
d2c9wa2103 Suppressor of cytokine signaling 2, SOCS-2 {Human 99.64
d1fu6a_111 Phosphatidylinositol 3-kinase, p85-alpha subunit { 99.63
d2cs0a1106 Hematopoietic SH2 domain containing protein HSH2D 99.62
d1xa6a2141 Beta-chimaerin, N-terminal domain {Human (Homo sap 99.45
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 99.44
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 99.31
d2pt0a1313 Myo-inositol hexaphosphate phosphohydrolase (phyta 99.17
d1uura3131 STAT homologue {Dictyostelium discoideum [TaxId: 4 98.87
d1rxda_152 Protein tyrosine phosphatase type IVa {Human (Homo 98.78
d1bg1a3141 STAT3b {Mouse (Mus musculus) [TaxId: 10090]} 98.74
d1bf5a3142 STAT-1 {Human (Homo sapiens) [TaxId: 9606]} 97.7
d3buxb388 Cbl {Human (Homo sapiens) [TaxId: 9606]} 95.21
d1bf5a3142 STAT-1 {Human (Homo sapiens) [TaxId: 9606]} 94.42
d1lara1317 RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} 93.81
d1ohea2182 Proline directed phosphatase CDC14b2 {Human (Homo 90.1
d1i9sa_194 mRNA capping enzyme, triphosphatase domain {Mouse 81.96
>d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: (Phosphotyrosine protein) phosphatases II
superfamily: (Phosphotyrosine protein) phosphatases II
family: Higher-molecular-weight phosphotyrosine protein phosphatases
domain: Tyrosine phosphatase
species: Human (Homo sapiens), shp-2 [TaxId: 9606]

Probab=100.00  E-value=5.3e-53  Score=400.37  Aligned_cols=216  Identities=60%  Similarity=1.017  Sum_probs=184.0

Q ss_pred             ccccccchhhhHHHhhhccC----CCccchHHHHhhhcccccccccccccccccCCCCCCCCCCCCCCCCceEecCCCCC
Q psy8516         232 TRITVSNIHDRVTELQKENS----SKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDED  307 (451)
Q Consensus       232 t~i~~~~l~~~v~~l~~~~~----~~~~~~~ef~~l~~~~~~~~~~~~~~~~~~n~~knR~~~i~p~d~~rv~l~~~~~~  307 (451)
                      |.+++++|.+++++|.+...    ...+|++||+.|....+....++..+..++|.+||||.||+|||+|||+|++.+++
T Consensus         1 t~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~~~N~~KNRy~~i~p~D~tRV~L~~~~~~   80 (307)
T d2shpa1           1 TRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPN   80 (307)
T ss_dssp             SCEEGGGHHHHHHHHHC----------CHHHHHHHHHGGGGGGCCCCHHHHSGGGGGGSSSTTCCCCTTTEEECCC----
T ss_pred             CeeeHHHHHHHHHHHHHHhhccchhHHHHHHHHHHhhCcCCCCCcchhhhcChhhhhcCCCCCCCCCcCCEEEccCCCCC
Confidence            56889999999999987655    45689999999988765555566778899999999999999999999999876656


Q ss_pred             CCCCCceeeEEe--------ecCCCCceEEEeCCCCcccHHHHHhHhhcccceEEEeeccccccCcccceeecCCCCCce
Q psy8516         308 VPGAEYINANYI--------QSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSK  379 (451)
Q Consensus       308 ~~~~~yinAs~v--------~~~~~~~~~I~tQ~P~~~t~~dFW~mv~~~~~~~Iv~l~~~~e~~~~~c~~YwP~~~~~~  379 (451)
                      .+++||||||||        +|+..++.|||||+|+++|++|||+||||++|.+|||||...|.+..+|.+|||.+++..
T Consensus        81 ~~~~dYINAs~i~~~~~~~~dg~~~~~~yIatQ~Pl~~Ti~dFW~MV~e~~~~~IVmL~~~~E~~~~kc~~YwP~~~~~~  160 (307)
T d2shpa1          81 EPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALK  160 (307)
T ss_dssp             ---CCEEEEEEECC-----------CCCEEEECCCCTTTHHHHHHHHHHHTCCEEEECSCSEETTEESCCCCSCCTTCEE
T ss_pred             CcccceeeeeeecccccccCCCCCCcceeEEECCCCccchHHHHHHHHhcccceEEeecccccCCcccccccCCCCCCce
Confidence            666899999999        788888999999999999999999999999999999999999999999999999988888


Q ss_pred             EEeeEEEEEeeeeeecCEEEEEEEEEeCC--CCCEEEEEEeeCCCCCCCCCCChHHHHHHHHHHHhhhcc
Q psy8516         380 TYGAVCVNNMYESVTTDYILREFLVSKGS--ESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDI  447 (451)
Q Consensus       380 ~~~~~~v~~~~~~~~~~~~~~~l~v~~~~--~~~~~v~~~~~~~Wp~~~~P~~~~~~l~~~~~v~~~~~~  447 (451)
                      .+|.++|++.++....+++.|.|.|...+  ...|+|+||||++|||+|+|.++..+++|+..|++.++.
T Consensus       161 ~~g~~~v~~~~~~~~~~~~~r~l~l~~~~~~~~~r~V~~~~~~~Wpd~~vP~~~~~ll~li~~v~~~~~~  230 (307)
T d2shpa1         161 EYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEVHHKQES  230 (307)
T ss_dssp             EETTEEEEEEEEEECSSEEEEEEEEEETTEEEEEEEEEEEEECCCCSSSCCSCHHHHHHHHHHHHHHHHH
T ss_pred             ecceEEEEEEEEEecCCeEEEEEEEEecCCCCcceEEEEEEeCCCCCCCCCCChHHHHHHHHHHHHHhhc
Confidence            99999999999999999999999998865  457999999999999999999999999999999988764
>d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Back     information, alignment and structure
>d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Back     information, alignment and structure
>d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Back     information, alignment and structure
>d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Back     information, alignment and structure
>d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Back     information, alignment and structure
>d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Back     information, alignment and structure
>d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Back     information, alignment and structure
>d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Back     information, alignment and structure
>d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3buxb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure