Diaphorina citri psyllid: psy8517

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610----

MEYRVILAVYLTSSMRLIQGRIYMQVTKEDISLSFPGPWTKYFMPYTYLLIWLGLADLFLIYSPRDQTNMKYSISAGPVVVHCSAGIGRTGTFIVIDMILDQIKKHGPVVVHCSAGIGRTGTFIVIDMILDQIKKHGLDCEIDIQRTIQHAWFKLKPSTNSSTSLFSITYKPYPNVSGMVQTEAQYKFVYLAVQHYIQTLSQRLIEEQKSIQLGREYTNIRCDCYDLYGGEKFATLSELVQFYMENQGKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTELQKENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNTRQDIHAGN

ccEEEEEEEEEEccEEEEEEEEEEEEEEEEEccccccccccccccccHHHHHHccEEEEEEEccccEEEEEccccccccEEEccccccccHHHHHHHHHHHHHHccccEEEECcccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHccccccEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccccccEEEEEccccEEEEEEEEcccccccccCEEEHHHHHHHHHHcccccccccccEEEEcccccccccccccHHHHHHHHHccccccccHHHHHHHccccccccccccHHcccccccccccccccccccccEEEECcccccccccccccccccccccccccEEEEcccccccccccccccccccEEEEEEEcccccccccccccccccccccCEEEEEEEEEEEEEEcccEEEEEEEEcccccccEEEEEEEcccccccccccccHHHHHHHHHHHHcccccccccccEEEEEEEccccccccEEEEEEEccccccccccccHHHHHHHHHHHHcccccccc

*EYRVILAVYLTSSMRLIQGRIYMQVTKEDISLSFPGPWTKYFMPYTYLLIWLGLADLFLIYSPRDQTNMKYSISAGPVVVHCSAGIGRTGTFIVIDMILDQIKKHGPVVVHCSAGIGRTGTFIVIDMILDQIKKHGLDCEIDIQRTIQHAWFKLKPSTNSSTSLFSITYKPYPNVSGMVQTEAQYKFVYLAVQHYIQTLSQRLIEEQKSIQLGREYTNIRCDCYDLYGGEKFATLSELVQFYMENQGK*AEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTELQKE**S*AGFWEEFESLQQQESRHL**********NRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVCVNNMYESVTTDYILREFLVSKGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVNT********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tyrosine-protein phosphatase non-receptor type 11	Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to participate in the signal transduction from the cell surface to the nucleus. Dephosphorylates ROCK2 at Tyr-722 resulting in stimulatation of its RhoA binding activity.	confident	P35235
Tyrosine-protein phosphatase non-receptor type 11	Acts downstream of various receptor and cytoplasmic protein tyrosine kinases to participate in the signal transduction from the cell surface to the nucleus. Dephosphorylates ROCK2 at Tyr-722 resulting in stimulatation of its RhoA binding activity.	confident	Q06124
Tyrosine-protein phosphatase non-receptor type 11	This PTPase activity may directly link growth factor receptors and other signaling proteins through protein-tyrosine phosphorylation. The SH2 regions may interact with other cellular components to modulate its own phosphatase activity against interacting substrates (By similarity). May play a positive role during the stages of erythroid cell proliferation.	confident	Q90687

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0050776 [BP]	regulation of immune response	probable	GO:0008150, GO:0048583, GO:0065007, GO:0002682, GO:0050789
GO:0035556 [BP]	intracellular signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0002684 [BP]	positive regulation of immune system process	probable	GO:0048518, GO:0065007, GO:0002682, GO:0050789, GO:0008150
GO:0005001 [MF]	transmembrane receptor protein tyrosine phosphatase activity	probable	GO:0016787, GO:0038023, GO:0016788, GO:0004725, GO:0004721, GO:0042578, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871, GO:0016791, GO:0019198, GO:0003824
GO:0038127 [BP]	ERBB signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0017124 [MF]	SH3 domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0018108 [BP]	peptidyl-tyrosine phosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0045087 [BP]	innate immune response	probable	GO:0002376, GO:0050896, GO:0006952, GO:0006950, GO:0008150, GO:0006955
GO:0051239 [BP]	regulation of multicellular organismal process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0043405 [BP]	regulation of MAP kinase activity	probable	GO:0019220, GO:0080090, GO:0019222, GO:0031323, GO:0023051, GO:0071900, GO:0010627, GO:0050789, GO:0043408, GO:0010646, GO:0009966, GO:0043549, GO:0051246, GO:0065007, GO:0031399, GO:0065009, GO:0045859, GO:0060255, GO:0048583, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0032268, GO:0051338, GO:0001932
GO:0035335 [BP]	peptidyl-tyrosine dephosphorylation	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0006470, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0042169 [MF]	SH2 domain binding	probable	GO:0003674, GO:0019904, GO:0005515, GO:0005488
GO:0043274 [MF]	phospholipase binding	probable	GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0014068 [BP]	positive regulation of phosphatidylinositol 3-kinase cascade	probable	GO:0010646, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0014066, GO:0050789, GO:0048522
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007
GO:0005102 [MF]	receptor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0070372 [BP]	regulation of ERK1 and ERK2 cascade	probable	GO:0009966, GO:0048583, GO:0050794, GO:0065007, GO:0023051, GO:0008150, GO:0010646, GO:0010627, GO:0050789, GO:0043408
GO:0050863 [BP]	regulation of T cell activation	probable	GO:0051249, GO:0050865, GO:0050794, GO:0008150, GO:0002694, GO:0002682, GO:0065007, GO:0050789
GO:0036302 [BP]	atrioventricular canal development	probable	GO:0032502, GO:0007507, GO:0032501, GO:0044707, GO:0072358, GO:0048856, GO:0044767, GO:0072359, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0060325 [BP]	face morphogenesis	probable	GO:0032502, GO:0048856, GO:0044767, GO:0060323, GO:0060322, GO:0008150, GO:0060324, GO:0010171, GO:0009653, GO:0044699
GO:0005070 [MF]	SH3/SH2 adaptor activity	probable	GO:0030674, GO:0035591, GO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0019901 [MF]	protein kinase binding	probable	GO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0048013 [BP]	ephrin receptor signaling pathway	probable	GO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:0007420 [BP]	brain development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0030154 [BP]	cell differentiation	probable	GO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0001933 [BP]	negative regulation of protein phosphorylation	probable	GO:0019220, GO:0080090, GO:0019222, GO:0031324, GO:0031323, GO:0009892, GO:0050789, GO:0051248, GO:0010605, GO:0010563, GO:0051246, GO:0065007, GO:0031399, GO:0048519, GO:0045936, GO:0060255, GO:0050794, GO:0051174, GO:0032268, GO:0008150, GO:0042325, GO:0032269, GO:0042326, GO:0031400, GO:0001932, GO:0048523
GO:2001275 [BP]	positive regulation of glucose import in response to insulin stimulus	probable	GO:0048584, GO:0051050, GO:0051049, GO:0008150, GO:0046326, GO:0048583, GO:0050794, GO:0050789, GO:0010827, GO:2001273, GO:0065007, GO:0046324, GO:1900076, GO:0048518, GO:1900078, GO:0032879, GO:0010828, GO:0048522
GO:0019221 [BP]	cytokine-mediated signaling pathway	probable	GO:0044700, GO:0051716, GO:0034097, GO:0008150, GO:0071345, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0071310, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0042221, GO:0007154, GO:0070887, GO:0010033, GO:0044699
GO:0009755 [BP]	hormone-mediated signaling pathway	probable	GO:0071495, GO:0044700, GO:0051716, GO:0009719, GO:0070887, GO:0008150, GO:0009725, GO:0050896, GO:0009987, GO:0071310, GO:0050794, GO:0050789, GO:0032870, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0042221, GO:0007154, GO:0010033, GO:0044699
GO:0009611 [BP]	response to wounding	probable	GO:0006950, GO:0008150, GO:0050896
GO:0048806 [BP]	genitalia development	probable	GO:0032502, GO:0007548, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:2000045 [BP]	regulation of G1/S transition of mitotic cell cycle	probable	GO:0007346, GO:0051726, GO:0010564, GO:0050794, GO:1901987, GO:0065007, GO:1901990, GO:0008150, GO:0050789
GO:0048839 [BP]	inner ear development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0007275, GO:0044699
GO:0042105 [CC]	alpha-beta T cell receptor complex	probable	GO:0043234, GO:0043235, GO:0032991, GO:0042101, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.1.-.-	Acting on ester bonds.	probable
3.1.3.-	Phosphoric monoester hydrolases.	probable
3.1.3.48	Protein-tyrosine-phosphatase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3PS5, chain A
Confidence level:very confident
Coverage over the Query: 208-573
View the alignment between query and template
View the model in PyMOL

Template: 1LAR, chain A
Confidence level:very confident
Coverage over the Query: 47-137,162-200,337-572
View the alignment between query and template
View the model in PyMOL

Template: 2P6X, chain A
Confidence level:very confident
Coverage over the Query: 345-607
View the alignment between query and template
View the model in PyMOL