Psyllid ID: psy8517
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 614 | ||||||
| 242020664 | 622 | tyrosine-protein phosphatase corkscrew, | 0.560 | 0.553 | 0.652 | 1e-142 | |
| 332375260 | 650 | unknown [Dendroctonus ponderosae] | 0.550 | 0.52 | 0.657 | 1e-138 | |
| 270015616 | 644 | hypothetical protein TcasGA2_TC012910 [T | 0.548 | 0.523 | 0.645 | 1e-136 | |
| 189242242 | 654 | PREDICTED: similar to protein tyrosine p | 0.548 | 0.515 | 0.645 | 1e-136 | |
| 383859792 | 616 | PREDICTED: tyrosine-protein phosphatase | 0.633 | 0.631 | 0.538 | 1e-132 | |
| 380028415 | 614 | PREDICTED: tyrosine-protein phosphatase | 0.617 | 0.617 | 0.550 | 1e-131 | |
| 328780747 | 615 | PREDICTED: tyrosine-protein phosphatase | 0.617 | 0.616 | 0.545 | 1e-131 | |
| 350412076 | 616 | PREDICTED: tyrosine-protein phosphatase | 0.617 | 0.615 | 0.547 | 1e-130 | |
| 340727604 | 616 | PREDICTED: tyrosine-protein phosphatase | 0.617 | 0.615 | 0.547 | 1e-129 | |
| 241742203 | 556 | protein tyrosine phosphatase, putative [ | 0.540 | 0.597 | 0.612 | 1e-129 |
| >gi|242020664|ref|XP_002430772.1| tyrosine-protein phosphatase corkscrew, putative [Pediculus humanus corporis] gi|212515969|gb|EEB18034.1| tyrosine-protein phosphatase corkscrew, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 511 bits (1315), Expect = e-142, Method: Compositional matrix adjust.
Identities = 261/400 (65%), Positives = 305/400 (76%), Gaps = 56/400 (14%)
Query: 210 SIQLGREYTNIRC----DCYDLYGGEKFATLSELVQFYMENQG----------------- 248
S++ E T+I+ D YDLYGGEKFATLSELVQ+Y+ENQG
Sbjct: 49 SVRRNGEVTHIKIQNTGDFYDLYGGEKFATLSELVQYYVENQGQVREKNGQVIELKYPLN 108
Query: 249 ----------------KEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIR 292
KEAE++IL+KGKNGSFLVRESQS+PG FVLSVRT+D+VTHV IR
Sbjct: 109 CADPTPERWFHGHISGKEAEKMILEKGKNGSFLVRESQSEPGHFVLSVRTEDRVTHVKIR 168
Query: 293 CQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTEL 352
CQ KYDVGGGE+F+SL++LIE+YK+NPMVETSGTVVHLKQPFNATRI S I RV EL
Sbjct: 169 CQENKYDVGGGERFESLSELIEYYKKNPMVETSGTVVHLKQPFNATRINASGIDTRVKEL 228
Query: 353 QKENSS---KAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKD 409
QKEN + KAGFWEEFESLQQQE RHLFTR++GQ+ +NRNKNRYKNILPFDHTRVKLK+
Sbjct: 229 QKENGAATGKAGFWEEFESLQQQECRHLFTRKQGQRPENRNKNRYKNILPFDHTRVKLKN 288
Query: 410 VDEDVPGAEYINANYIQ-----------SEDGGKSYIATQGCLPSTMNDFWSMVWQENVR 458
D ++PG+EYINANYI+ SE G KSYIATQGCLPST+ D W MVWQENVR
Sbjct: 289 ADPNIPGSEYINANYIRQEPQEGSGLAGSEVGLKSYIATQGCLPSTVADLWMMVWQENVR 348
Query: 459 VIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVS--KGSES 516
VIVMTTKE+ERGKNKCA+YWPD +QSK YG + V ++ E+ T+DY LR+FLVS +G+E
Sbjct: 349 VIVMTTKEIERGKNKCARYWPDKNQSKEYGPIKVCSVSETSTSDYTLRQFLVSSEEGTEQ 408
Query: 517 PRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVCVNNMYESV 556
+ IYHYHFQAWPDHGVPSDPGCVLNFL++ VN ES+
Sbjct: 409 -KTIYHYHFQAWPDHGVPSDPGCVLNFLHD--VNARQESI 445
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332375260|gb|AEE62771.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|270015616|gb|EFA12064.1| hypothetical protein TcasGA2_TC012910 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189242242|ref|XP_971440.2| PREDICTED: similar to protein tyrosine phosphatase, non-receptor type 11 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383859792|ref|XP_003705376.1| PREDICTED: tyrosine-protein phosphatase corkscrew-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|380028415|ref|XP_003697898.1| PREDICTED: tyrosine-protein phosphatase corkscrew-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328780747|ref|XP_003249854.1| PREDICTED: tyrosine-protein phosphatase corkscrew [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350412076|ref|XP_003489537.1| PREDICTED: tyrosine-protein phosphatase corkscrew-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340727604|ref|XP_003402130.1| PREDICTED: tyrosine-protein phosphatase corkscrew-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|241742203|ref|XP_002414169.1| protein tyrosine phosphatase, putative [Ixodes scapularis] gi|215508023|gb|EEC17477.1| protein tyrosine phosphatase, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 614 | ||||||
| FB|FBgn0000382 | 845 | csw "corkscrew" [Drosophila me | 0.304 | 0.221 | 0.704 | 4.5e-121 | |
| UNIPROTKB|Q24708 | 764 | csw "Tyrosine-protein phosphat | 0.296 | 0.238 | 0.683 | 9.2e-107 | |
| UNIPROTKB|I3LLQ6 | 414 | LOC100623964 "Uncharacterized | 0.488 | 0.724 | 0.590 | 8.7e-98 | |
| UNIPROTKB|F1N376 | 514 | LOC526769 "Uncharacterized pro | 0.669 | 0.799 | 0.480 | 5.5e-93 | |
| UNIPROTKB|I3LQJ5 | 535 | I3LQJ5 "Uncharacterized protei | 0.488 | 0.560 | 0.596 | 1.3e-91 | |
| ZFIN|ZDB-GENE-040426-1158 | 592 | ptpn11b "protein tyrosine phos | 0.576 | 0.597 | 0.517 | 4.5e-91 | |
| UNIPROTKB|E1BTC5 | 592 | LOC419429 "Uncharacterized pro | 0.565 | 0.586 | 0.524 | 3.1e-90 | |
| UNIPROTKB|F1Q3J6 | 593 | PTPN11 "Uncharacterized protei | 0.618 | 0.640 | 0.492 | 5.1e-90 | |
| UNIPROTKB|F1N339 | 597 | PTPN11 "Uncharacterized protei | 0.617 | 0.634 | 0.491 | 1.1e-89 | |
| UNIPROTKB|F1N843 | 604 | PTPN6 "Uncharacterized protein | 0.480 | 0.488 | 0.496 | 1.2e-89 |
| FB|FBgn0000382 csw "corkscrew" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 681 (244.8 bits), Expect = 4.5e-121, Sum P(3) = 4.5e-121
Identities = 136/193 (70%), Positives = 156/193 (80%)
Query: 242 FYMENQGKEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRCQAEKYDVG 301
F+ GKEAE+LIL++GKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIR Q +KYDVG
Sbjct: 112 FHGNLSGKEAEKLILERGKNGSFLVRESQSKPGDFVLSVRTDDKVTHVMIRWQDKKYDVG 171
Query: 302 GGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITVSNIHDRVTELQKENSSKAG 361
GGE F +L++LI+HYKRNPMVET GTVVHL+QPFNATRIT + I+ RV +L K G
Sbjct: 172 GGESFGTLSELIDHYKRNPMVETCGTVVHLRQPFNATRITAAGINARVEQLVK-----GG 226
Query: 362 FWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDEDVPGAEYIN 421
FWEEFESLQQ +SR F+R EG K +NR KNRY+NILP+DHTRVKL DV+ V GAEYIN
Sbjct: 227 FWEEFESLQQ-DSRDTFSRNEGYKQENRLKNRYRNILPYDHTRVKLLDVEHSVAGAEYIN 285
Query: 422 ANYIQSEDGGKSY 434
ANYI+ G Y
Sbjct: 286 ANYIRLPTDGDLY 298
|
|
| UNIPROTKB|Q24708 csw "Tyrosine-protein phosphatase corkscrew" [Drosophila virilis (taxid:7244)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LLQ6 LOC100623964 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N376 LOC526769 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3LQJ5 I3LQJ5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1158 ptpn11b "protein tyrosine phosphatase, non-receptor type 11, b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BTC5 LOC419429 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1Q3J6 PTPN11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N339 PTPN11 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N843 PTPN6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 614 | |||
| cd00047 | 231 | cd00047, PTPc, Protein tyrosine phosphatases (PTP) | 3e-74 | |
| smart00194 | 259 | smart00194, PTPc, Protein tyrosine phosphatase, ca | 3e-72 | |
| pfam00102 | 233 | pfam00102, Y_phosphatase, Protein-tyrosine phospha | 2e-65 | |
| cd09931 | 99 | cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo | 2e-54 | |
| COG5599 | 302 | COG5599, PTP2, Protein tyrosine phosphatase [Signa | 3e-33 | |
| PHA02738 | 320 | PHA02738, PHA02738, hypothetical protein; Provisio | 8e-33 | |
| PHA02742 | 303 | PHA02742, PHA02742, protein tyrosine phosphatase; | 1e-27 | |
| cd10340 | 99 | cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo | 1e-25 | |
| PHA02747 | 312 | PHA02747, PHA02747, protein tyrosine phosphatase; | 5e-25 | |
| pfam00017 | 77 | pfam00017, SH2, SH2 domain | 1e-24 | |
| smart00252 | 84 | smart00252, SH2, Src homology 2 domains | 1e-22 | |
| PHA02746 | 323 | PHA02746, PHA02746, protein tyrosine phosphatase; | 9e-20 | |
| cd00047 | 231 | cd00047, PTPc, Protein tyrosine phosphatases (PTP) | 2e-18 | |
| cd00173 | 79 | cd00173, SH2, Src homology 2 (SH2) domain | 2e-17 | |
| smart00194 | 259 | smart00194, PTPc, Protein tyrosine phosphatase, ca | 4e-17 | |
| pfam00102 | 233 | pfam00102, Y_phosphatase, Protein-tyrosine phospha | 6e-17 | |
| cd09937 | 98 | cd09937, SH2_csk_like, Src homology 2 (SH2) domain | 3e-16 | |
| smart00404 | 105 | smart00404, PTPc_motif, Protein tyrosine phosphata | 3e-16 | |
| smart00012 | 105 | smart00012, PTPc_DSPc, Protein tyrosine phosphatas | 3e-16 | |
| cd09933 | 101 | cd09933, SH2_Src_family, Src homology 2 (SH2) doma | 8e-15 | |
| cd09935 | 94 | cd09935, SH2_ABL, Src homology 2 (SH2) domain foun | 3e-14 | |
| cd10341 | 99 | cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src | 6e-14 | |
| cd10340 | 99 | cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo | 1e-13 | |
| cd00047 | 231 | cd00047, PTPc, Protein tyrosine phosphatases (PTP) | 4e-13 | |
| smart00194 | 259 | smart00194, PTPc, Protein tyrosine phosphatase, ca | 6e-13 | |
| PHA02740 | 298 | PHA02740, PHA02740, protein tyrosine phosphatase; | 1e-12 | |
| cd09941 | 95 | cd09941, SH2_Grb2_like, Src homology 2 domain foun | 1e-12 | |
| cd10347 | 81 | cd10347, SH2_Nterm_shark_like, N-terminal Src homo | 2e-12 | |
| cd09932 | 104 | cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src | 3e-12 | |
| cd10370 | 96 | cd10370, SH2_Src_Src42, Src homology 2 (SH2) domai | 3e-12 | |
| cd10355 | 92 | cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma | 4e-12 | |
| pfam00102 | 233 | pfam00102, Y_phosphatase, Protein-tyrosine phospha | 7e-12 | |
| cd10361 | 90 | cd10361, SH2_Fps_family, Src homology 2 (SH2) doma | 2e-11 | |
| cd10354 | 77 | cd10354, SH2_Cterm_RasGAP, C-terminal Src homology | 2e-11 | |
| cd10348 | 86 | cd10348, SH2_Cterm_shark_like, C-terminal Src homo | 1e-10 | |
| cd10353 | 103 | cd10353, SH2_Nterm_RasGAP, N-terminal Src homology | 2e-10 | |
| cd09926 | 106 | cd09926, SH2_CRK_like, Src homology 2 domain found | 2e-10 | |
| cd09943 | 93 | cd09943, SH2_Nck_family, Src homology 2 (SH2) doma | 2e-10 | |
| cd10408 | 97 | cd10408, SH2_Nck1, Src homology 2 (SH2) domain fou | 5e-10 | |
| cd10337 | 136 | cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in | 6e-10 | |
| cd10409 | 98 | cd10409, SH2_Nck2, Src homology 2 (SH2) domain fou | 7e-10 | |
| COG5599 | 302 | COG5599, PTP2, Protein tyrosine phosphatase [Signa | 1e-09 | |
| cd09944 | 108 | cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom | 2e-09 | |
| cd09929 | 121 | cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) dom | 3e-09 | |
| cd09930 | 104 | cd09930, SH2_cSH2_p85_like, C-terminal Src homolog | 8e-09 | |
| cd10369 | 96 | cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain | 1e-08 | |
| cd09938 | 104 | cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src | 1e-08 | |
| cd10367 | 101 | cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain | 5e-08 | |
| cd10362 | 101 | cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain | 8e-08 | |
| cd10401 | 99 | cd10401, SH2_C-SH2_Syk_like, C-terminal Src homolo | 8e-08 | |
| cd10366 | 101 | cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain | 1e-07 | |
| cd09942 | 110 | cd09942, SH2_nSH2_p85_like, N-terminal Src homolog | 1e-07 | |
| cd09945 | 98 | cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 | 1e-07 | |
| cd10414 | 108 | cd10414, SH2_Grb14, Src homology 2 (SH2) domain fo | 2e-07 | |
| cd10418 | 101 | cd10418, SH2_Src_Fyn_isoform_a_like, Src homology | 2e-07 | |
| cd10346 | 97 | cd10346, SH2_SH2B_family, Src homology 2 (SH2) dom | 4e-07 | |
| cd09934 | 104 | cd09934, SH2_Tec_family, Src homology 2 (SH2) doma | 5e-07 | |
| cd09940 | 102 | cd09940, SH2_Vav_family, Src homology 2 (SH2) doma | 5e-07 | |
| PHA02746 | 323 | PHA02746, PHA02746, protein tyrosine phosphatase; | 7e-07 | |
| cd10343 | 103 | cd10343, SH2_SHIP, Src homology 2 (SH2) domain fou | 7e-07 | |
| cd10371 | 100 | cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain | 8e-07 | |
| cd10344 | 104 | cd10344, SH2_SLAP, Src homology 2 domain found in | 9e-07 | |
| COG5599 | 302 | COG5599, PTP2, Protein tyrosine phosphatase [Signa | 1e-06 | |
| PHA02746 | 323 | PHA02746, PHA02746, protein tyrosine phosphatase; | 1e-06 | |
| PHA02738 | 320 | PHA02738, PHA02738, hypothetical protein; Provisio | 2e-06 | |
| cd10382 | 98 | cd10382, SH2_SOCS1, Src homology 2 (SH2) domain fo | 2e-06 | |
| cd10405 | 103 | cd10405, SH2_Vav1, Src homology 2 (SH2) domain fou | 2e-06 | |
| cd10368 | 101 | cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain | 2e-06 | |
| cd10365 | 101 | cd10365, SH2_Src_Src, Src homology 2 (SH2) domain | 2e-06 | |
| cd10363 | 104 | cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain | 4e-06 | |
| cd10413 | 108 | cd10413, SH2_Grb7, Src homology 2 (SH2) domain fou | 4e-06 | |
| cd10419 | 101 | cd10419, SH2_Src_Fyn_isoform_b_like, Src homology | 5e-06 | |
| cd10417 | 102 | cd10417, SH2_SH2D7, Src homology 2 domain found in | 6e-06 | |
| cd10397 | 106 | cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain | 7e-06 | |
| cd10360 | 79 | cd10360, SH2_Srm, Src homology 2 (SH2) domain foun | 7e-06 | |
| cd10399 | 106 | cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain | 8e-06 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 1e-05 | |
| cd10415 | 108 | cd10415, SH2_Grb10, Src homology 2 (SH2) domain fo | 1e-05 | |
| cd10384 | 101 | cd10384, SH2_SOCS3, Src homology 2 (SH2) domain fo | 1e-05 | |
| cd10349 | 77 | cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain f | 2e-05 | |
| cd09925 | 104 | cd09925, SH2_SHC, Src homology 2 (SH2) domain foun | 2e-05 | |
| smart00195 | 138 | smart00195, DSPc, Dual specificity phosphatase, ca | 3e-05 | |
| cd10364 | 101 | cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain | 4e-05 | |
| cd10396 | 108 | cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain | 5e-05 | |
| smart00404 | 105 | smart00404, PTPc_motif, Protein tyrosine phosphata | 6e-05 | |
| smart00012 | 105 | smart00012, PTPc_DSPc, Protein tyrosine phosphatas | 6e-05 | |
| cd10410 | 97 | cd10410, SH2_SH2B1, Src homology 2 (SH2) domain fo | 8e-05 | |
| pfam00782 | 131 | pfam00782, DSPc, Dual specificity phosphatase, cat | 9e-05 | |
| PHA02747 | 312 | PHA02747, PHA02747, protein tyrosine phosphatase; | 1e-04 | |
| cd10352 | 91 | cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 | 1e-04 | |
| PHA02747 | 312 | PHA02747, PHA02747, protein tyrosine phosphatase; | 2e-04 | |
| cd10402 | 105 | cd10402, SH2_C-SH2_Zap70, C-terminal Src homology | 2e-04 | |
| cd10390 | 98 | cd10390, SH2_SHD, Src homology 2 domain found in S | 2e-04 | |
| cd09923 | 81 | cd09923, SH2_SOCS_family, Src homology 2 (SH2) dom | 2e-04 | |
| cd10388 | 101 | cd10388, SH2_SOCS7, Src homology 2 (SH2) domain fo | 2e-04 | |
| cd10383 | 103 | cd10383, SH2_SOCS2, Src homology 2 (SH2) domain fo | 3e-04 | |
| cd10406 | 103 | cd10406, SH2_Vav2, Src homology 2 (SH2) domain fou | 3e-04 | |
| cd10407 | 103 | cd10407, SH2_Vav3, Src homology 2 (SH2) domain fou | 4e-04 | |
| cd10392 | 98 | cd10392, SH2_SHF, Src homology 2 domain found in S | 4e-04 | |
| smart00404 | 105 | smart00404, PTPc_motif, Protein tyrosine phosphata | 5e-04 | |
| smart00012 | 105 | smart00012, PTPc_DSPc, Protein tyrosine phosphatas | 5e-04 | |
| PHA02746 | 323 | PHA02746, PHA02746, protein tyrosine phosphatase; | 8e-04 | |
| cd10342 | 103 | cd10342, SH2_SAP1, Src homology 2 (SH2) domain fou | 9e-04 | |
| cd10389 | 97 | cd10389, SH2_SHB, Src homology 2 domain found in S | 0.001 | |
| cd10398 | 106 | cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain | 0.001 | |
| COG2453 | 180 | COG2453, CDC14, Predicted protein-tyrosine phospha | 0.003 | |
| cd10411 | 97 | cd10411, SH2_SH2B2, Src homology 2 (SH2) domain fo | 0.003 | |
| PHA02738 | 320 | PHA02738, PHA02738, hypothetical protein; Provisio | 0.004 | |
| PHA02742 | 303 | PHA02742, PHA02742, protein tyrosine phosphatase; | 0.004 |
| >gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
Score = 236 bits (605), Expect = 3e-74
Identities = 78/158 (49%), Positives = 108/158 (68%), Gaps = 3/158 (1%)
Query: 391 KNRYKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGGKSYIATQGCLPSTMNDFWS 450
KNRYK+ILP+DHTRVKLK D+ G++YINA+YI + K+YIATQG LP+T+ DFW
Sbjct: 2 KNRYKDILPYDHTRVKLKPDDD--EGSDYINASYIDGYNPPKAYIATQGPLPNTVEDFWR 59
Query: 451 MVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLV 510
MVW++ V VIVM T+ +E+G+ KCA+YWP++ S TYG + V + E DY +R +
Sbjct: 60 MVWEQKVPVIVMLTELVEKGREKCAQYWPEEEGSLTYGDITVTLVSEEKLDDYTVRTLKL 119
Query: 511 S-KGSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEV 547
S G+ R + H+ + WPDHGVP P +L+ L +V
Sbjct: 120 SNTGTGETRTVTHFQYTGWPDHGVPESPDSLLDLLRKV 157
|
The depth of the active site cleft renders the enzyme specific for phosphorylated Tyr (pTyr) residues, instead of pSer or pThr. This family has a distinctive active site signature motif, HCSAGxGRxG. Characterized as either transmembrane, receptor-like or non-transmembrane (soluble) PTPs. Receptor-like PTP domains tend to occur in two copies in the cytoplasmic region of the transmembrane proteins, only one copy may be active. Length = 231 |
| >gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215658 pfam00017, SH2, SH2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214585 smart00252, SH2, Src homology 2 domains | Back alignment and domain information |
|---|
| >gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|198190 cd09937, SH2_csk_like, Src homology 2 (SH2) domain found in Carboxyl-Terminal Src Kinase (Csk) | Back alignment and domain information |
|---|
| >gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the Src oncogene at 42A (Src42) | Back alignment and domain information |
|---|
| >gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198211 cd10348, SH2_Cterm_shark_like, C-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198180 cd09926, SH2_CRK_like, Src homology 2 domain found in cancer-related signaling adaptor protein CRK | Back alignment and domain information |
|---|
| >gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family | Back alignment and domain information |
|---|
| >gnl|CDD|198271 cd10408, SH2_Nck1, Src homology 2 (SH2) domain found in Nck | Back alignment and domain information |
|---|
| >gnl|CDD|198200 cd10337, SH2_BCAR3, Src homology 2 (SH2) domain in the Breast Cancer Anti-estrogen Resistance protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|198272 cd10409, SH2_Nck2, Src homology 2 (SH2) domain found in Nck | Back alignment and domain information |
|---|
| >gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198183 cd09929, SH2_BLNK_SLP-76, Src homology 2 (SH2) domain found in B-cell linker (BLNK) protein and SH2 domain-containing leukocyte protein of 76 kDa (SLP-76) | Back alignment and domain information |
|---|
| >gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) | Back alignment and domain information |
|---|
| >gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr | Back alignment and domain information |
|---|
| >gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte cell kinase (Lck) | Back alignment and domain information |
|---|
| >gnl|CDD|198264 cd10401, SH2_C-SH2_Syk_like, C-terminal Src homology 2 (SH2) domain found in Spleen tyrosine kinase (Syk) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes | Back alignment and domain information |
|---|
| >gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|198277 cd10414, SH2_Grb14, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 14 (Grb14) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain found in Fyn isoform a like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198209 cd10346, SH2_SH2B_family, Src homology 2 (SH2) domain found in SH2B adapter protein family | Back alignment and domain information |
|---|
| >gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in Tec-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198193 cd09940, SH2_Vav_family, Src homology 2 (SH2) domain found in the Vav family | Back alignment and domain information |
|---|
| >gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198206 cd10343, SH2_SHIP, Src homology 2 (SH2) domain found in SH2-containing inositol-5'-phosphatase (SHIP) and SLAM-associated protein (SAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198234 cd10371, SH2_Src_Blk, Src homology 2 (SH2) domain found in B lymphoid kinase (Blk) | Back alignment and domain information |
|---|
| >gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198245 cd10382, SH2_SOCS1, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198268 cd10405, SH2_Vav1, Src homology 2 (SH2) domain found in the Vav1 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn | Back alignment and domain information |
|---|
| >gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in tyrosine kinase sarcoma (Src) | Back alignment and domain information |
|---|
| >gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK | Back alignment and domain information |
|---|
| >gnl|CDD|198276 cd10413, SH2_Grb7, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199832 cd10417, SH2_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 7 (SH2D7) | Back alignment and domain information |
|---|
| >gnl|CDD|198260 cd10397, SH2_Tec_Btk, Src homology 2 (SH2) domain found in Tec protein, Bruton's tyrosine kinase (Btk) | Back alignment and domain information |
|---|
| >gnl|CDD|198223 cd10360, SH2_Srm, Src homology 2 (SH2) domain found in Src-related kinase lacking C-terminal regulatory tyrosine and N-terminal myristoylation sites (srm) | Back alignment and domain information |
|---|
| >gnl|CDD|198262 cd10399, SH2_Tec_Bmx, Src homology 2 (SH2) domain found in Tec protein, Bmx | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|198278 cd10415, SH2_Grb10, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 10 (Grb10) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198247 cd10384, SH2_SOCS3, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199830 cd10349, SH2_SH2D2A_SH2D7, Src homology 2 domain found in the SH2 domain containing protein 2A and 7 (SH2D2A and SH2D7) | Back alignment and domain information |
|---|
| >gnl|CDD|198179 cd09925, SH2_SHC, Src homology 2 (SH2) domain found in SH2 adaptor protein C (SHC) | Back alignment and domain information |
|---|
| >gnl|CDD|214551 smart00195, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|198259 cd10396, SH2_Tec_Itk, Src homology 2 (SH2) domain found in Tec protein, IL2-inducible T-cell kinase (Itk) | Back alignment and domain information |
|---|
| >gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >gnl|CDD|198273 cd10410, SH2_SH2B1, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|216117 pfam00782, DSPc, Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins | Back alignment and domain information |
|---|
| >gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198265 cd10402, SH2_C-SH2_Zap70, C-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) | Back alignment and domain information |
|---|
| >gnl|CDD|198253 cd10390, SH2_SHD, Src homology 2 domain found in SH2 domain-containing adapter proteins D (SHD) | Back alignment and domain information |
|---|
| >gnl|CDD|198178 cd09923, SH2_SOCS_family, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) family | Back alignment and domain information |
|---|
| >gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198246 cd10383, SH2_SOCS2, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198269 cd10406, SH2_Vav2, Src homology 2 (SH2) domain found in the Vav2 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198270 cd10407, SH2_Vav3, Src homology 2 (SH2) domain found in the Vav3 proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198255 cd10392, SH2_SHF, Src homology 2 domain found in SH2 domain-containing adapter protein F (SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198205 cd10342, SH2_SAP1, Src homology 2 (SH2) domain found in SLAM-associated protein (SAP)1 | Back alignment and domain information |
|---|
| >gnl|CDD|198252 cd10389, SH2_SHB, Src homology 2 domain found in SH2 domain-containing adapter protein B (SHB) | Back alignment and domain information |
|---|
| >gnl|CDD|198261 cd10398, SH2_Tec_Txk, Src homology 2 (SH2) domain found in Tec protein, Txk | Back alignment and domain information |
|---|
| >gnl|CDD|225297 COG2453, CDC14, Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|198274 cd10411, SH2_SH2B2, Src homology 2 (SH2) domain found in SH2B adapter proteins (SH2B1, SH2B2, SH2B3) | Back alignment and domain information |
|---|
| >gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 614 | |||
| KOG0790|consensus | 600 | 100.0 | ||
| KOG4228|consensus | 1087 | 100.0 | ||
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 100.0 | |
| KOG0792|consensus | 1144 | 100.0 | ||
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 100.0 | |
| KOG4228|consensus | 1087 | 100.0 | ||
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 100.0 | |
| KOG0791|consensus | 374 | 100.0 | ||
| KOG0790|consensus | 600 | 100.0 | ||
| KOG0793|consensus | 1004 | 100.0 | ||
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 100.0 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 100.0 | |
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 99.98 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 99.96 | |
| KOG0789|consensus | 415 | 99.94 | ||
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 99.93 | |
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 99.9 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 99.89 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 99.89 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 99.88 | |
| KOG0792|consensus | 1144 | 99.83 | ||
| KOG0791|consensus | 374 | 99.81 | ||
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 99.79 | |
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 99.76 | |
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 99.74 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 99.7 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 99.7 | |
| PF00017 | 77 | SH2: SH2 domain; InterPro: IPR000980 The Src homol | 99.67 | |
| cd00173 | 94 | SH2 Src homology 2 domains; Signal transduction, i | 99.67 | |
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 99.64 | |
| smart00252 | 84 | SH2 Src homology 2 domains. Src homology 2 domains | 99.63 | |
| KOG0793|consensus | 1004 | 99.63 | ||
| KOG4226|consensus | 379 | 99.63 | ||
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 99.61 | |
| KOG0789|consensus | 415 | 99.55 | ||
| KOG4278|consensus | 1157 | 99.43 | ||
| KOG1264|consensus | 1267 | 99.32 | ||
| KOG4637|consensus | 464 | 99.27 | ||
| KOG4637|consensus | 464 | 99.25 | ||
| KOG0197|consensus | 468 | 99.2 | ||
| KOG2996|consensus | 865 | 99.18 | ||
| KOG4792|consensus | 293 | 99.16 | ||
| KOG1264|consensus | 1267 | 99.04 | ||
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 98.86 | |
| KOG0194|consensus | 474 | 98.81 | ||
| KOG1720|consensus | 225 | 98.51 | ||
| KOG3601|consensus | 222 | 98.5 | ||
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 98.32 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 98.14 | |
| smart00195 | 138 | DSPc Dual specificity phosphatase, catalytic domai | 97.91 | |
| KOG1930|consensus | 483 | 97.91 | ||
| COG2453 | 180 | CDC14 Predicted protein-tyrosine phosphatase [Sign | 97.89 | |
| PF00782 | 133 | DSPc: Dual specificity phosphatase, catalytic doma | 97.74 | |
| KOG3697|consensus | 345 | 97.31 | ||
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 97.18 | |
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 97.18 | |
| KOG3751|consensus | 622 | 97.0 | ||
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 96.77 | |
| PRK12361 | 547 | hypothetical protein; Provisional | 96.51 | |
| KOG2836|consensus | 173 | 96.15 | ||
| KOG1718|consensus | 198 | 95.67 | ||
| PF05706 | 168 | CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3) | 95.43 | |
| KOG1719|consensus | 183 | 94.41 | ||
| KOG4566|consensus | 258 | 93.66 | ||
| KOG1716|consensus | 285 | 92.97 | ||
| PF13350 | 164 | Y_phosphatase3: Tyrosine phosphatase family; PDB: | 92.69 | |
| KOG1717|consensus | 343 | 92.15 | ||
| PF03162 | 164 | Y_phosphatase2: Tyrosine phosphatase family; Inter | 92.03 | |
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 90.89 | |
| PF14566 | 149 | PTPlike_phytase: Inositol hexakisphosphate; PDB: 1 | 90.87 | |
| TIGR01244 | 135 | conserved hypothetical protein TIGR01244. No membe | 90.86 | |
| COG5350 | 172 | Predicted protein tyrosine phosphatase [General fu | 88.91 | |
| KOG2283|consensus | 434 | 84.95 | ||
| KOG1856|consensus | 1299 | 84.62 | ||
| COG2365 | 249 | Protein tyrosine/serine phosphatase [Signal transd | 83.72 | |
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 83.49 | |
| KOG1856|consensus | 1299 | 83.47 |
| >KOG0790|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-81 Score=629.65 Aligned_cols=369 Identities=64% Similarity=1.014 Sum_probs=336.4
Q ss_pred hhhhhhhcccccccC----CcccccCCCcccCChhhhh---------------------------------hhcccCCch
Q psy8517 207 EQKSIQLGREYTNIR----CDCYDLYGGEKFATLSELV---------------------------------QFYMENQGK 249 (614)
Q Consensus 207 ~~~s~~~~~~~~~~~----~~~~~~~~~~~~~~~~e~~---------------------------------~~y~~~~~~ 249 (614)
..++++.+.+.+||+ |++|+.|+||+|+++.|++ |||+.+++.
T Consensus 41 fsl~~r~~~~v~hikiq~~~~~~~l~~gekfat~~ELvqyyme~~~~lkekng~~ielK~pl~cAdptserWfHG~Lsgk 120 (600)
T KOG0790|consen 41 FSLSVRRGDKVTHIKIQNSGDFYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLNCADPTSERWFHGHLSGK 120 (600)
T ss_pred eeEEEEeCCceEEEEEeecCccccccCCccccchHHHHHHHHhhhHHHHhcCCCEEEecCCCccCCchhhhhhccCCCch
Confidence 336788899999999 8899999999999999887 666667788
Q ss_pred HHHHHHHccCCCCcEEEeecCCCCCCeEEEEEeCC---------eEEEEEEeecCCeeecCCCccccCHHHHHHhcccCC
Q psy8517 250 EAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDD---------KVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNP 320 (614)
Q Consensus 250 eae~lL~~~~~~G~FLvR~S~s~~g~~~LSv~~~~---------~v~h~~I~~~~~~~~~~~~~~F~sl~eLV~~y~~~~ 320 (614)
+||+||+..+++|+||||+|.|.||+|+||+++++ +|+|++|.|.+++|+++|++.|+|+.+||+||+++|
T Consensus 121 eAekLl~ekgk~gsfLvReSqs~PGdfVlSvrTdd~~~~~~~~~kVtHvmI~~q~~kydVGgge~F~sltdLidhykknp 200 (600)
T KOG0790|consen 121 EAEKLLQEKGKHGSFLVRESQSHPGDFVLSVRTDDKKESNDSKLKVTHVMIRCQEGKYDVGGGERFDSLTDLVEHYKKNP 200 (600)
T ss_pred hHHHHHHhcCCCccEEEeccccCCCceEEEEEcCCcccCCCCccceEEEEEEecccccccCCccccchHHHHHHHhccCc
Confidence 99999999999999999999999999999999988 999999999999999999999999999999999999
Q ss_pred eecccCeEEEecCCcccccccccccchHHHHHhhccC----CCCcchHHHHHHhhhcccccccccccccccccCCCCCCC
Q psy8517 321 MVETSGTVVHLKQPFNATRITVSNIHDRVTELQKENS----SKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKN 396 (614)
Q Consensus 321 l~~~~g~~~~L~~P~~~t~~~~~~l~~~~~~l~~~~~----~~~g~~~Ef~~l~~~~~~~~~~~~~~~~~~n~~kNR~~~ 396 (614)
+.+..|.++.|++|++.|++++..+..|+.+|.+... .+.||++||++|++.+....+++.++.+++|+.||||.|
T Consensus 201 mvEt~gtvv~LrqP~naTrI~Aa~i~~Rve~l~k~~e~~d~~k~GfwEEFesLqq~~~~~~~sr~EG~r~eN~~KNRYkN 280 (600)
T KOG0790|consen 201 MVETLGTVVYLRQPLNATRINAADIENRVEELNKKQESEDTAKAGFWEEFESLQQQEVKNLHSRLEGQRPENKGKNRYKN 280 (600)
T ss_pred hhhhcceeEEeeccccccchhhhhHHHHHHHHhccccchhhhhcchhHHHHHhhhhhhHhhhhhhccccchhhccccccc
Confidence 9999999999999999999999999999999987532 789999999999998888888999999999999999999
Q ss_pred CCCCCCcceeecCCCCCCCCCceeeeeeeccC--------CCCceEEEecCCCCCchhhhhcceeccccceEEeeccccc
Q psy8517 397 ILPFDHTRVKLKDVDEDVPGAEYINANYIQSE--------DGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEME 468 (614)
Q Consensus 397 i~p~d~tRV~L~~~~~~~~~~dYINAs~I~g~--------~~~~~yIatQ~Pl~~T~~dFW~mvwe~~~~~IVmLt~~~e 468 (614)
|+|||||||+|...+++.+++||||||||-.- ..++.||||||-|.+|+.|||+||||+|+++|||.|.+.|
T Consensus 281 IlPfDHtRViL~d~~~n~pgsdYINAnyi~~~~q~~~~~~~~kKsyIAtQGCL~nTVnDFW~MvwQENsrVIVMtTkE~E 360 (600)
T KOG0790|consen 281 ILPFDHTRVILQDRDPNIPGSDYINANYIMIEFQRLCNNSKPKKSYIATQGCLQNTVNDFWRMVWQENSRVIVMTTKEVE 360 (600)
T ss_pred cCcccceeeEeecCCCCCccchhcccchhhhhhhhccCccccccceeehhhHHHHHHHHHHHHHHhccceEEEEehhhhh
Confidence 99999999999999899999999999998533 2346899999999999999999999999999999999999
Q ss_pred cCcccccccCCCCCCCeeeecEEEEeEEEeeecCEEEEEEEEEeCC--CCceEEEEeeecCCCCCCCCCChHHHHHHHHH
Q psy8517 469 RGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGS--ESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYE 546 (614)
Q Consensus 469 ~~~~kc~~YwP~~~~~~~~g~~~V~~~~~~~~~~~~~r~l~v~~~~--~~~r~v~~~~~~~WPd~gvP~~~~~~l~~i~~ 546 (614)
+|++||.+|||+++....||.+.|++.++....+|++|+|.++... ...|.|+||||..|||||+|.+|+++|+|+.+
T Consensus 361 RgK~KC~~YWPee~~~e~~G~~~v~~v~E~~t~dY~LR~l~vs~~~~g~~~R~I~~yh~~tWPDHGvP~dPg~vLnFLe~ 440 (600)
T KOG0790|consen 361 RGKSKCVKYWPEEGALEEYGVMRVRNVKESDTHDYTLRELKVSKLGNGNLEREIWHYHYLTWPDHGVPSDPGGVLNFLEE 440 (600)
T ss_pred cccccccccCCcccchhhcCceEEEeccccccccceehheeeccccCCcchhhhhhhheeecccCCCcCCccHHHHHHHH
Confidence 9999999999998888889999999999999999999999999543 67999999999999999999999999999999
Q ss_pred Hhhccccccccc-cceeEEEeecCCCCCCceEEE
Q psy8517 547 VCVNNMYESVTT-DYILREFLVSKGSESPRKIYH 579 (614)
Q Consensus 547 V~v~~~~e~~~~-~~ilR~~~~s~~~~~~R~i~h 579 (614)
| +..+++-.. ..|+ .+|+++-|.+.++.=
T Consensus 441 V--~~rq~~l~~AgpIv--VHCSAGIGrTGTfiV 470 (600)
T KOG0790|consen 441 V--NHRQESLMDAGPIV--VHCSAGIGRTGTFIV 470 (600)
T ss_pred h--hhhhccccccCcEE--EEccCCcCCcceEEE
Confidence 9 776665322 2333 378888876665543
|
|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0792|consensus | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] | Back alignment and domain information |
|---|
| >cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >smart00252 SH2 Src homology 2 domains | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >KOG1720|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >smart00195 DSPc Dual specificity phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >KOG1930|consensus | Back alignment and domain information |
|---|
| >COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF00782 DSPc: Dual specificity phosphatase, catalytic domain; InterPro: IPR000340 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >KOG3697|consensus | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >PRK12361 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
| >KOG1718|consensus | Back alignment and domain information |
|---|
| >PF05706 CDKN3: Cyclin-dependent kinase inhibitor 3 (CDKN3); InterPro: IPR022778 This entry represents a domain found in cyclin-dependent kinase inhibitor 3 or kinase associated phosphatase proteins from several mammalian species | Back alignment and domain information |
|---|
| >KOG1719|consensus | Back alignment and domain information |
|---|
| >KOG4566|consensus | Back alignment and domain information |
|---|
| >KOG1716|consensus | Back alignment and domain information |
|---|
| >PF13350 Y_phosphatase3: Tyrosine phosphatase family; PDB: 1YWF_A 2OZ5_B | Back alignment and domain information |
|---|
| >KOG1717|consensus | Back alignment and domain information |
|---|
| >PF03162 Y_phosphatase2: Tyrosine phosphatase family; InterPro: IPR004861 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >PF14566 PTPlike_phytase: Inositol hexakisphosphate; PDB: 1U24_A 2PSZ_B 3MOZ_A 3D1H_B 2B4P_B 3D1Q_A 2B4O_A 3MMJ_B 1U25_A 1U26_B | Back alignment and domain information |
|---|
| >TIGR01244 conserved hypothetical protein TIGR01244 | Back alignment and domain information |
|---|
| >COG5350 Predicted protein tyrosine phosphatase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2283|consensus | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 614 | ||||
| 2shp_A | 525 | Tyrosine Phosphatase Shp-2 Length = 525 | 1e-119 | ||
| 3ps5_A | 595 | Crystal Structure Of The Full-Length Human Protein | 1e-102 | ||
| 2b3o_A | 532 | Crystal Structure Of Human Tyrosine Phosphatase Shp | 1e-102 | ||
| 3b7o_A | 316 | Crystal Structure Of The Human Tyrosine Phosphatase | 2e-66 | ||
| 4gry_A | 288 | Crystal Structure Of Shp1 Catalytic Domain With Jak | 2e-61 | ||
| 4gs0_A | 308 | Crystal Structure Of Shp1 Catalytic Domain With Jak | 3e-61 | ||
| 1fpr_A | 284 | Crystal Structure Of The Complex Formed Between The | 4e-61 | ||
| 1gwz_A | 299 | Crystal Structure Of The Catalytic Domain Of The Pr | 5e-61 | ||
| 3o5x_A | 276 | Crystal Structure Of The Oncogenic Tyrosine Phospha | 8e-58 | ||
| 2ooq_A | 286 | Crystal Structure Of The Human Receptor Phosphatase | 3e-39 | ||
| 3s3e_A | 307 | Crystal Structure Of The Catalytic Domain Of Ptp10d | 3e-39 | ||
| 2h02_A | 313 | Structural Studies Of Protein Tyrosine Phosphatase | 6e-39 | ||
| 2ahs_A | 295 | Crystal Structure Of The Catalytic Domain Of Human | 8e-39 | ||
| 2c7s_A | 313 | Crystal Structure Of Human Protein Tyrosine Phospha | 2e-36 | ||
| 3i36_A | 342 | Crystal Structure Of Rat Protein Tyrosine Phosphata | 3e-36 | ||
| 2h03_A | 291 | Structural Studies Of Protein Tyrosine Phosphatase | 4e-36 | ||
| 2h03_A | 291 | Structural Studies Of Protein Tyrosine Phosphatase | 2e-04 | ||
| 1lar_A | 575 | Crystal Structure Of The Tandem Phosphatase Domains | 4e-36 | ||
| 2pbn_A | 313 | Crystal Structure Of The Human Tyrosine Receptor Ph | 5e-36 | ||
| 3qcl_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 6e-36 | ||
| 2nz6_A | 316 | Crystal Structure Of The Ptprj Inactivating Mutant | 6e-36 | ||
| 1rpm_A | 278 | Human Receptor Protein Tyrosine Phosphatase Mu, Dom | 7e-36 | ||
| 3qcb_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 7e-36 | ||
| 2h4v_A | 320 | Crystal Structure Of The Human Tyrosine Receptor Ph | 7e-36 | ||
| 2nlk_A | 627 | Crystal Structure Of D1 And D2 Catalytic Domains Of | 8e-36 | ||
| 3olr_A | 313 | Ptpn22 In Complex With Consensus Phospho-Tyrosine P | 1e-35 | ||
| 3olr_A | 313 | Ptpn22 In Complex With Consensus Phospho-Tyrosine P | 1e-05 | ||
| 2qcj_A | 313 | Native Structure Of Lyp Length = 313 | 1e-35 | ||
| 2qcj_A | 313 | Native Structure Of Lyp Length = 313 | 1e-05 | ||
| 2p6x_A | 309 | Crystal Structure Of Human Tyrosine Phosphatase Ptp | 1e-35 | ||
| 2p6x_A | 309 | Crystal Structure Of Human Tyrosine Phosphatase Ptp | 1e-05 | ||
| 3h2x_A | 302 | Crystal Structure Of The Human Lymphoid Tyrosine Ph | 1e-35 | ||
| 3h2x_A | 302 | Crystal Structure Of The Human Lymphoid Tyrosine Ph | 1e-05 | ||
| 2nv5_A | 299 | Crystal Structure Of A C-Terminal Phosphatase Domai | 2e-35 | ||
| 3qcm_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 2e-35 | ||
| 3brh_A | 310 | Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To | 1e-34 | ||
| 3brh_A | 310 | Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To | 9e-05 | ||
| 1ptu_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 2e-34 | ||
| 1ptv_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 2e-34 | ||
| 1l8g_A | 321 | Crystal Structure Of Ptp1b Complexed With 7-(1,1-di | 2e-34 | ||
| 1gfy_A | 298 | Residue 259 Is A Key Determinant Of Substrate Speci | 2e-34 | ||
| 1ecv_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 2e-34 | ||
| 2cfv_A | 316 | Crystal Structure Of Human Protein Tyrosine Phospha | 2e-34 | ||
| 1c86_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 2e-34 | ||
| 2hy3_A | 313 | Crystal Structure Of The Human Tyrosine Receptor Ph | 3e-34 | ||
| 4i8n_A | 354 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 4e-34 | ||
| 3zv2_A | 320 | Human Protein-Tyrosine Phosphatase 1b C215a, S216a | 4e-34 | ||
| 1g1f_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 4e-34 | ||
| 3sr9_A | 583 | Crystal Structure Of Mouse Ptpsigma Length = 583 | 4e-34 | ||
| 1een_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 4e-34 | ||
| 1aax_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 4e-34 | ||
| 2azr_A | 299 | Crystal Structure Of Ptp1b With Bicyclic Thiophene | 4e-34 | ||
| 1bzh_A | 298 | Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 | 4e-34 | ||
| 1g7g_A | 298 | Human Ptp1b Catalytic Domain Complexes With Pnu1793 | 4e-34 | ||
| 2cm2_A | 304 | Structure Of Protein Tyrosine Phosphatase 1b (P2121 | 4e-34 | ||
| 2nt7_A | 299 | Crystal Structure Of Ptp1b-inhibitor Complex Length | 4e-34 | ||
| 1oeo_X | 321 | Ptp1b With The Catalytic Cysteine Oxidized To Sulfo | 4e-34 | ||
| 3sme_A | 300 | Structure Of Ptp1b Inactivated By H2o2BICARBONATE L | 4e-34 | ||
| 3eu0_A | 327 | Crystal Structure Of The S-Nitrosylated Cys215 Of P | 4e-34 | ||
| 1bzc_A | 321 | Human Ptp1b Catalytic Domain Complexed With Tpi Len | 5e-34 | ||
| 2cma_A | 327 | Structural Basis For Inhibition Of Protein Tyrosine | 5e-34 | ||
| 1nl9_A | 321 | Potent, Selective Protein Tyrosine Phosphatase 1b I | 5e-34 | ||
| 1bzj_A | 297 | Human Ptp1b Complexed With Tpicooh Length = 297 | 5e-34 | ||
| 1g7f_A | 298 | Human Ptp1b Catalytic Domain Complexed With Pnu1774 | 5e-34 | ||
| 3cwe_A | 290 | Ptp1b In Complex With A Phosphonic Acid Inhibitor L | 5e-34 | ||
| 1nwl_A | 298 | Crystal Structure Of The Ptp1b Complexed With Sp734 | 5e-34 | ||
| 1a5y_A | 330 | Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate | 6e-34 | ||
| 2f6f_A | 302 | The Structure Of The S295f Mutant Of Human Ptp1b Le | 7e-34 | ||
| 1lqf_A | 295 | Structure Of Ptp1b In Complex With A Peptidic Bisph | 7e-34 | ||
| 1i57_A | 310 | Crystal Structure Of Apo Human Ptp1b (C215s) Mutant | 1e-33 | ||
| 2fjm_A | 310 | The Structure Of Phosphotyrosine Phosphatase 1b In | 1e-33 | ||
| 1q6j_A | 310 | The Structure Of Phosphotyrosine Phosphatase 1b In | 1e-33 | ||
| 1pa1_A | 310 | Crystal Structure Of The C215d Mutant Of Protein Ty | 1e-33 | ||
| 1yfo_A | 302 | Receptor Protein Tyrosine Phosphatase Alpha, Domain | 1e-33 | ||
| 2jjd_A | 599 | Protein Tyrosine Phosphatase, Receptor Type, E Isof | 1e-33 | ||
| 2pi7_A | 312 | Structure Of The Catalytic Domain Of The Chick Reti | 2e-33 | ||
| 2oc3_A | 303 | Crystal Structure Of The Catalytic Domain Of Human | 3e-33 | ||
| 2fh7_A | 595 | Crystal Structure Of The Phosphatase Domains Of Hum | 3e-33 | ||
| 1l8k_A | 314 | T Cell Protein-Tyrosine Phosphatase Structure Lengt | 4e-33 | ||
| 3qkp_A | 321 | Protein Tyrosine Phosphatase 1b - Apo W179f Mutant | 6e-33 | ||
| 2gjt_A | 295 | Crystal Structure Of The Human Receptor Phosphatase | 6e-33 | ||
| 2g59_A | 297 | Crystal Structure Of The Catalytic Domain Of Protei | 6e-33 | ||
| 3a5k_A | 304 | Crystal Structure Of Protein-Tyrosine Phosphatase 1 | 1e-32 | ||
| 1ygr_A | 610 | Crystal Structure Of The Tandem Phosphatase Domain | 2e-32 | ||
| 1ygr_A | 610 | Crystal Structure Of The Tandem Phosphatase Domain | 1e-04 | ||
| 2i75_A | 320 | Crystal Structure Of Human Protein Tyrosine Phospha | 2e-29 | ||
| 2b49_A | 287 | Crystal Structure Of The Catalytic Domain Of Protei | 8e-29 | ||
| 1wch_A | 315 | Crystal Structure Of Ptpl1 Human Tyrosine Phosphata | 2e-28 | ||
| 3d42_A | 308 | Crystal Structure Of Heptp In Complex With A Monoph | 2e-28 | ||
| 2hvl_A | 309 | Crystal Structure Of The Heptp Catalytic Domain C27 | 3e-28 | ||
| 1zc0_A | 309 | Crystal Structure Of Human Hematopoietic Tyrosine P | 3e-28 | ||
| 2a3k_A | 296 | Crystal Structure Of The Human Protein Tyrosine Pho | 3e-28 | ||
| 3o4s_A | 308 | Crystal Structure Of Heptp With A Closed Wpd Loop A | 4e-28 | ||
| 2gp0_A | 309 | Heptp Catalytic Domain (Residues 44-339), S225d Mut | 4e-28 | ||
| 2cjz_A | 305 | Crystal Structure Of The C472s Mutant Of Human Prot | 1e-27 | ||
| 2bv5_A | 282 | Crystal Structure Of The Human Protein Tyrosine Pho | 1e-27 | ||
| 2bij_A | 305 | Crystal Structure Of The Human Protein Tyrosine Pho | 1e-27 | ||
| 2qdm_A | 309 | Crystal Structure Of The Heptp Catalytic Domain C27 | 2e-27 | ||
| 2qdc_A | 309 | Crystal Structure Of The Heptp Catalytic Domain D23 | 2e-27 | ||
| 2bzl_A | 325 | Crystal Structure Of The Human Protein Tyrosine Pho | 5e-27 | ||
| 2pa5_A | 314 | Crystal Structure Of Human Protein Tyrosine Phospha | 9e-27 | ||
| 2pa5_A | 314 | Crystal Structure Of Human Protein Tyrosine Phospha | 9e-04 | ||
| 1p15_A | 253 | Crystal Structure Of The D2 Domain Of Rptpa Length | 9e-26 | ||
| 2i1y_A | 301 | Crystal Structure Of The Phosphatase Domain Of Huma | 5e-25 | ||
| 1jln_A | 297 | Crystal Structure Of The Catalytic Domain Of Protei | 6e-25 | ||
| 2qep_A | 304 | Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be | 7e-25 | ||
| 2a8b_A | 283 | Crystal Structure Of The Catalytic Domain Of Human | 9e-25 | ||
| 1x6c_A | 118 | Solution Structures Of The Sh2 Domain Of Human Prot | 4e-20 | ||
| 3tl0_A | 109 | Structure Of Shp2 N-Sh2 Domain In Complex With Rlnp | 4e-17 | ||
| 1aya_A | 101 | Crystal Structures Of Peptide Complexes Of The Amin | 4e-17 | ||
| 4az1_A | 302 | Crystal Structure Of The Trypanosoma Cruzi Protein | 1e-15 | ||
| 3m4u_A | 306 | Crystal Structure Of Trypanosoma Brucei Protein Tyr | 2e-13 | ||
| 2lqn_A | 303 | Solution Structure Of Crkl Length = 303 | 2e-08 | ||
| 2lqw_A | 303 | Solution Structure Of Phosphorylated Crkl Length = | 2e-08 | ||
| 2eo3_A | 111 | Solution Structure Of The Sh2 Domain From Human Crk | 2e-08 | ||
| 2ci8_A | 99 | Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomple | 6e-08 | ||
| 2ci9_A | 102 | Nck1 Sh2-Domain In Complex With A Dodecaphosphopept | 7e-08 | ||
| 3eaz_A | 106 | Crystal Structure Of Sh2 Domain Of Human Csk (Carbo | 9e-08 | ||
| 3eac_A | 106 | Crystal Structure Of Sh2 Domain Of Human Csk (Carbo | 1e-07 | ||
| 1k9a_A | 450 | Crystal Structure Analysis Of Full-Length Carboxyl- | 3e-07 | ||
| 2cia_A | 102 | Human Nck2 Sh2-Domain In Complex With A Decaphospho | 7e-07 | ||
| 1z3k_A | 98 | Structural Insight Into The Binding Diversity Betwe | 7e-07 | ||
| 1opk_A | 495 | Structural Basis For The Auto-Inhibition Of C-Abl T | 9e-07 | ||
| 2fo0_A | 495 | Organization Of The Sh3-Sh2 Unit In Active And Inac | 1e-06 | ||
| 1opl_A | 537 | Structural Basis For The Auto-Inhibition Of C-Abl T | 1e-06 | ||
| 2abl_A | 163 | Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine K | 1e-06 | ||
| 1ab2_A | 109 | Three-Dimensional Solution Structure Of The Src Hom | 2e-06 | ||
| 2kk6_A | 116 | Solution Structure Of Sh2 Domain Of Proto-Oncogene | 2e-06 | ||
| 2fci_A | 105 | Structural Basis For The Requirement Of Two Phospho | 2e-06 | ||
| 3t04_A | 123 | Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN C | 3e-06 | ||
| 3k2m_A | 112 | Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN CO | 3e-06 | ||
| 2gsb_A | 119 | Solution Structure Of The Second Sh2 Domain Of Huma | 3e-06 | ||
| 4fbn_A | 246 | Insights Into Structural Integration Of The Plcgamm | 3e-06 | ||
| 3gqi_B | 226 | Crystal Structure Of Activated Receptor Tyrosine Ki | 3e-06 | ||
| 4ey0_A | 246 | Structure Of Tandem Sh2 Domains From Plcgamma1 Leng | 3e-06 | ||
| 1jyq_A | 96 | Xray Structure Of Grb2 Sh2 Domain Complexed With A | 4e-06 | ||
| 1fyr_A | 114 | Dimer Formation Through Domain Swapping In The Crys | 5e-06 | ||
| 1bm2_A | 117 | Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet | 5e-06 | ||
| 1bmb_A | 123 | Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 | 6e-06 | ||
| 3n84_A | 112 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 6e-06 | ||
| 1tze_E | 98 | Signal Transduction Adaptor Growth Factor, Grb2 Sh2 | 6e-06 | ||
| 1cj1_A | 96 | Growth Factor Receptor Binding Protein Sh2 Domain ( | 6e-06 | ||
| 3ove_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 6e-06 | ||
| 3imd_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 6e-06 | ||
| 2ecd_A | 119 | Solution Structure Of The Human Abl2 Sh2 Domain Len | 6e-06 | ||
| 3mxc_A | 101 | Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp | 6e-06 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 6e-06 | ||
| 2h46_E | 116 | Native Domain-Swapped Dimer Crystal Structure Of Th | 6e-06 | ||
| 1fhs_A | 112 | The Three-Dimensional Solution Structure Of The Src | 7e-06 | ||
| 2aoa_A | 99 | Crystal Structures Of A High-affinity Macrocyclic P | 7e-06 | ||
| 1zfp_E | 98 | Growth Factor Receptor Binding Protein Sh2 Domain C | 7e-06 | ||
| 1ghu_A | 107 | Nmr Solution Structure Of Growth Factor Receptor-Bo | 7e-06 | ||
| 1x0n_A | 104 | Nmr Structure Of Growth Factor Receptor Binding Pro | 7e-06 | ||
| 1r1p_A | 100 | Structural Basis For Differential Recognition Of Ty | 8e-06 | ||
| 1ju5_A | 109 | Ternary Complex Of An Crk Sh2 Domain, Crk-Derived P | 1e-05 | ||
| 2dx0_A | 138 | Crystal Structure Of The N-Terminal Sh2 Domain Of M | 2e-05 | ||
| 2aug_A | 126 | Crystal Structure Of The Grb14 Sh2 Domain Length = | 2e-05 | ||
| 2eyy_A | 204 | Ct10-Regulated Kinase Isoform I Length = 204 | 2e-05 | ||
| 2eyv_A | 124 | Sh2 Domain Of Ct10-Regulated Kinase Length = 124 | 2e-05 | ||
| 2dly_A | 121 | Solution Structure Of The Sh2 Domain Of Murine Fyn- | 2e-05 | ||
| 2ysx_A | 119 | Solution Structure Of The Human Ship Sh2 Domain Len | 3e-05 | ||
| 2dvj_A | 230 | Phosphorylated Crk-Ii Length = 230 | 3e-05 | ||
| 2eyz_A | 304 | Ct10-Regulated Kinase Isoform Ii Length = 304 | 3e-05 | ||
| 1aot_F | 106 | Nmr Structure Of The Fyn Sh2 Domain Complexed With | 4e-05 | ||
| 1g83_A | 165 | Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | 5e-05 | ||
| 2lct_A | 107 | Solution Structure Of The Vav1 Sh2 Domain Complexed | 5e-05 | ||
| 1jwo_A | 97 | Crystal Structure Analysis Of The Sh2 Domain Of The | 7e-05 | ||
| 3uf4_A | 164 | Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P | 1e-04 | ||
| 2lnw_A | 122 | Identification And Structural Basis For A Novel Int | 1e-04 | ||
| 2crh_A | 138 | Solution Structure Of The Sh2 Domain Of Human Proto | 1e-04 | ||
| 2dlz_A | 118 | Solution Structure Of The Sh2 Domain Of Human Prote | 1e-04 | ||
| 1mw4_A | 120 | Solution Structure Of The Human Grb7-Sh2 Domain In | 2e-04 | ||
| 3pqz_A | 117 | Grb7 Sh2 With Peptide Length = 117 | 2e-04 | ||
| 4f59_A | 112 | Triple Mutant Src Sh2 Domain Length = 112 | 2e-04 | ||
| 1wqu_A | 114 | Solution Structure Of The Human Fes Sh2 Domain Leng | 2e-04 | ||
| 4fl3_A | 635 | Structural And Biophysical Characterization Of The | 3e-04 | ||
| 4fl2_A | 636 | Structural And Biophysical Characterization Of The | 3e-04 | ||
| 3bkb_A | 377 | Crystal Structure Of Human Feline Sarcoma Viral Onc | 3e-04 | ||
| 3cd3_A | 377 | Crystal Structure Of Phosphorylated Human Feline Sa | 3e-04 | ||
| 1ijr_A | 104 | Crystal Structure Of Lck Sh2 Complexed With Nonpept | 3e-04 | ||
| 1csy_A | 112 | Syk Tyrosine Kinase C-Terminal Sh2 Domain Complexed | 4e-04 | ||
| 1o41_A | 108 | Crystal Structure Of Sh2 In Complex With Ru78300. L | 4e-04 | ||
| 1a81_A | 254 | Crystal Structure Of The Tandem Sh2 Domain Of The S | 4e-04 | ||
| 1fbz_A | 104 | Structure-Based Design Of A Novel, Osteoclast-Selec | 4e-04 | ||
| 1shd_A | 107 | Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein In | 4e-04 | ||
| 3us4_A | 98 | Crystal Structure Of A Sh2 Domain Of A Megakaryocyt | 4e-04 | ||
| 1lcj_A | 109 | Sh2 (Src Homology-2) Domain Of Human P56-Lck Tyrosi | 5e-04 | ||
| 1y57_A | 452 | Structure Of Unphosphorylated C-Src In Complex With | 5e-04 | ||
| 1fmk_A | 452 | Crystal Structure Of Human Tyrosine-Protein Kinase | 5e-04 | ||
| 4d8k_A | 175 | Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphoc | 5e-04 | ||
| 1bhf_A | 108 | P56lck Sh2 Domain Inhibitor Complex Length = 108 | 5e-04 | ||
| 1ksw_A | 452 | Structure Of Human C-Src Tyrosine Kinase (Thr338gly | 5e-04 | ||
| 1o4c_A | 108 | Crystal Structure Of Sh2 In Complex With Phosphate. | 5e-04 | ||
| 1lkk_A | 105 | Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex | 5e-04 | ||
| 1cwd_L | 98 | Human P56lck Tyrosine Kinase Complexed With Phospho | 5e-04 | ||
| 1bhh_B | 103 | Free P56lck Sh2 Domain Length = 103 | 5e-04 | ||
| 1lkl_A | 104 | Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex | 6e-04 | ||
| 2h8h_A | 535 | Src Kinase In Complex With A Quinazoline Inhibitor | 6e-04 | ||
| 1a1a_A | 107 | C-Src (Sh2 Domain With C188a Mutation) Complexed Wi | 6e-04 | ||
| 1f1w_A | 104 | Src Sh2 Thref1trp Mutant Complexed With The Phospho | 6e-04 | ||
| 2ekx_A | 110 | Solution Structure Of The Human Bmx Sh2 Domain Leng | 6e-04 | ||
| 1nzl_A | 103 | Crystal Structure Of Src Sh2 Domain Bound To Doubly | 6e-04 | ||
| 1sha_A | 104 | Crystal Structure Of The Phosphotyrosine Recognitio | 7e-04 | ||
| 1is0_A | 106 | Crystal Structure Of A Complex Of The Src Sh2 Domai | 7e-04 | ||
| 1p13_A | 102 | Crystal Structure Of The Src Sh2 Domain Complexed W | 7e-04 | ||
| 1skj_A | 113 | Cocrystal Structure Of Urea-Substituted Phosphopept | 8e-04 | ||
| 1lck_A | 175 | Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine K | 8e-04 | ||
| 1h9o_A | 112 | Phosphatidylinositol 3-Kinase, P85-Alpha Subunit: C | 8e-04 | ||
| 2ptk_A | 453 | Chicken Src Tyrosine Kinase Length = 453 | 8e-04 | ||
| 1x27_A | 167 | Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding S | 8e-04 |
| >pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 | Back alignment and structure |
|
| >pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 | Back alignment and structure |
| >pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 | Back alignment and structure |
| >pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 | Back alignment and structure |
| >pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 | Back alignment and structure |
| >pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 | Back alignment and structure |
| >pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 | Back alignment and structure |
| >pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 | Back alignment and structure |
| >pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 | Back alignment and structure |
| >pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 | Back alignment and structure |
| >pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 | Back alignment and structure |
| >pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 | Back alignment and structure |
| >pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 | Back alignment and structure |
| >pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 | Back alignment and structure |
| >pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 | Back alignment and structure |
| >pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 | Back alignment and structure |
| >pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 | Back alignment and structure |
| >pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 | Back alignment and structure |
| >pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 | Back alignment and structure |
| >pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 | Back alignment and structure |
| >pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 | Back alignment and structure |
| >pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 | Back alignment and structure |
| >pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 | Back alignment and structure |
| >pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 | Back alignment and structure |
| >pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 | Back alignment and structure |
| >pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 | Back alignment and structure |
| >pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 | Back alignment and structure |
| >pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 | Back alignment and structure |
| >pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 | Back alignment and structure |
| >pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 | Back alignment and structure |
| >pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 | Back alignment and structure |
| >pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 | Back alignment and structure |
| >pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 | Back alignment and structure |
| >pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 | Back alignment and structure |
| >pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 | Back alignment and structure |
| >pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 | Back alignment and structure |
| >pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 | Back alignment and structure |
| >pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 | Back alignment and structure |
| >pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 | Back alignment and structure |
| >pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 | Back alignment and structure |
| >pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 | Back alignment and structure |
| >pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 | Back alignment and structure |
| >pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 | Back alignment and structure |
| >pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 | Back alignment and structure |
| >pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 | Back alignment and structure |
| >pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 | Back alignment and structure |
| >pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 | Back alignment and structure |
| >pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 | Back alignment and structure |
| >pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 | Back alignment and structure |
| >pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 | Back alignment and structure |
| >pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 | Back alignment and structure |
| >pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 | Back alignment and structure |
| >pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 | Back alignment and structure |
| >pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 | Back alignment and structure |
| >pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 | Back alignment and structure |
| >pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 | Back alignment and structure |
| >pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 | Back alignment and structure |
| >pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 | Back alignment and structure |
| >pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 | Back alignment and structure |
| >pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 | Back alignment and structure |
| >pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 | Back alignment and structure |
| >pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 | Back alignment and structure |
| >pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 | Back alignment and structure |
| >pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 | Back alignment and structure |
| >pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 | Back alignment and structure |
| >pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 | Back alignment and structure |
| >pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 | Back alignment and structure |
| >pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 | Back alignment and structure |
| >pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 | Back alignment and structure |
| >pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 | Back alignment and structure |
| >pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 | Back alignment and structure |
| >pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 | Back alignment and structure |
| >pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 | Back alignment and structure |
| >pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 | Back alignment and structure |
| >pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 | Back alignment and structure |
| >pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 | Back alignment and structure |
| >pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 | Back alignment and structure |
| >pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 | Back alignment and structure |
| >pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 | Back alignment and structure |
| >pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 | Back alignment and structure |
| >pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 | Back alignment and structure |
| >pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 | Back alignment and structure |
| >pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 | Back alignment and structure |
| >pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 | Back alignment and structure |
| >pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 | Back alignment and structure |
| >pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 | Back alignment and structure |
| >pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 | Back alignment and structure |
| >pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 | Back alignment and structure |
| >pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 | Back alignment and structure |
| >pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 | Back alignment and structure |
| >pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 | Back alignment and structure |
| >pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 | Back alignment and structure |
| >pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 | Back alignment and structure |
| >pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 | Back alignment and structure |
| >pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 | Back alignment and structure |
| >pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 | Back alignment and structure |
| >pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 | Back alignment and structure |
| >pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 | Back alignment and structure |
| >pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 | Back alignment and structure |
| >pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 | Back alignment and structure |
| >pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 | Back alignment and structure |
| >pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 | Back alignment and structure |
| >pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 | Back alignment and structure |
| >pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 | Back alignment and structure |
| >pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 | Back alignment and structure |
| >pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 | Back alignment and structure |
| >pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 | Back alignment and structure |
| >pdb|1X6C|A Chain A, Solution Structures Of The Sh2 Domain Of Human Protein- Tyrosine Phosphatase Shp-1 Length = 118 | Back alignment and structure |
| >pdb|3TL0|A Chain A, Structure Of Shp2 N-Sh2 Domain In Complex With Rlnpyaqlwhr Peptide Length = 109 | Back alignment and structure |
| >pdb|1AYA|A Chain A, Crystal Structures Of Peptide Complexes Of The Amino- Terminal Sh2 Domain Of The Syp Tyrosine Phosphatase Length = 101 | Back alignment and structure |
| >pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 | Back alignment and structure |
| >pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 | Back alignment and structure |
| >pdb|2LQN|A Chain A, Solution Structure Of Crkl Length = 303 | Back alignment and structure |
| >pdb|2LQW|A Chain A, Solution Structure Of Phosphorylated Crkl Length = 303 | Back alignment and structure |
| >pdb|2EO3|A Chain A, Solution Structure Of The Sh2 Domain From Human Crk-Like Protein Length = 111 | Back alignment and structure |
| >pdb|2CI8|A Chain A, Sh2 Domain Of Human Nck1 Adaptor Protein - Uncomplexed Length = 99 | Back alignment and structure |
| >pdb|2CI9|A Chain A, Nck1 Sh2-Domain In Complex With A Dodecaphosphopeptide From Epec Protein Tir Length = 102 | Back alignment and structure |
| >pdb|3EAZ|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), C122s Mutant Length = 106 | Back alignment and structure |
| >pdb|3EAC|A Chain A, Crystal Structure Of Sh2 Domain Of Human Csk (Carboxyl- Terminal Src Kinase), Oxidized Form Length = 106 | Back alignment and structure |
| >pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 | Back alignment and structure |
| >pdb|2CIA|A Chain A, Human Nck2 Sh2-Domain In Complex With A Decaphosphopeptide From Translocated Intimin Receptor (Tir) Of Epec Length = 102 | Back alignment and structure |
| >pdb|1Z3K|A Chain A, Structural Insight Into The Binding Diversity Between The Tyr-Phosphorylated Human Ephrinbs And Nck2 Sh2 Domain Length = 98 | Back alignment and structure |
| >pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 | Back alignment and structure |
| >pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 | Back alignment and structure |
| >pdb|2ABL|A Chain A, Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine Kinase Length = 163 | Back alignment and structure |
| >pdb|1AB2|A Chain A, Three-Dimensional Solution Structure Of The Src Homology 2 Domain Of C-Abl Length = 109 | Back alignment and structure |
| >pdb|2KK6|A Chain A, Solution Structure Of Sh2 Domain Of Proto-Oncogene Tyrosine- Protein Kinase Fer From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr3461d Length = 116 | Back alignment and structure |
| >pdb|2FCI|A Chain A, Structural Basis For The Requirement Of Two Phosphotyrosines In Signaling Mediated By Syk Tyrosine Kinase Length = 105 | Back alignment and structure |
| >pdb|3T04|A Chain A, Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN COMPLEX Length = 123 | Back alignment and structure |
| >pdb|3K2M|A Chain A, Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN COMPLEX Length = 112 | Back alignment and structure |
| >pdb|2GSB|A Chain A, Solution Structure Of The Second Sh2 Domain Of Human Ras Gtpase-Activating Protein 1 Length = 119 | Back alignment and structure |
| >pdb|4FBN|A Chain A, Insights Into Structural Integration Of The Plcgamma Regulatory Region And Mechanism Of Autoinhibition And Activation Based On Key Roles Of Sh2 Domains Length = 246 | Back alignment and structure |
| >pdb|3GQI|B Chain B, Crystal Structure Of Activated Receptor Tyrosine Kinase In Complex With Substrates Length = 226 | Back alignment and structure |
| >pdb|4EY0|A Chain A, Structure Of Tandem Sh2 Domains From Plcgamma1 Length = 246 | Back alignment and structure |
| >pdb|1JYQ|A Chain A, Xray Structure Of Grb2 Sh2 Domain Complexed With A Highly Affine Phospho Peptide Length = 96 | Back alignment and structure |
| >pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 | Back alignment and structure |
| >pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 | Back alignment and structure |
| >pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 | Back alignment and structure |
| >pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 | Back alignment and structure |
| >pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 | Back alignment and structure |
| >pdb|1CJ1|A Chain A, Growth Factor Receptor Binding Protein Sh2 Domain (Human) Complexed With A Phosphotyrosyl Derivative Length = 96 | Back alignment and structure |
| >pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 | Back alignment and structure |
| >pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 | Back alignment and structure |
| >pdb|2ECD|A Chain A, Solution Structure Of The Human Abl2 Sh2 Domain Length = 119 | Back alignment and structure |
| >pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 | Back alignment and structure |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
| >pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 | Back alignment and structure |
| >pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 | Back alignment and structure |
| >pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 | Back alignment and structure |
| >pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 | Back alignment and structure |
| >pdb|1GHU|A Chain A, Nmr Solution Structure Of Growth Factor Receptor-Bound Protein 2 (Grb2) Sh2 Domain, 24 Structures Length = 107 | Back alignment and structure |
| >pdb|1X0N|A Chain A, Nmr Structure Of Growth Factor Receptor Binding Protein Sh2 Domain Complexed With The Inhibitor Length = 104 | Back alignment and structure |
| >pdb|1R1P|A Chain A, Structural Basis For Differential Recognition Of Tyrosine Phosphorylated Sites In The Linker For Activation Of T Cells (lat) By The Adaptor Protein Gads Length = 100 | Back alignment and structure |
| >pdb|1JU5|A Chain A, Ternary Complex Of An Crk Sh2 Domain, Crk-Derived Phophopeptide, And Abl Sh3 Domain By Nmr Spectroscopy Length = 109 | Back alignment and structure |
| >pdb|2DX0|A Chain A, Crystal Structure Of The N-Terminal Sh2 Domain Of Mouse Phospholipase C-Gamma 2 Length = 138 | Back alignment and structure |
| >pdb|2AUG|A Chain A, Crystal Structure Of The Grb14 Sh2 Domain Length = 126 | Back alignment and structure |
| >pdb|2EYY|A Chain A, Ct10-Regulated Kinase Isoform I Length = 204 | Back alignment and structure |
| >pdb|2EYV|A Chain A, Sh2 Domain Of Ct10-Regulated Kinase Length = 124 | Back alignment and structure |
| >pdb|2DLY|A Chain A, Solution Structure Of The Sh2 Domain Of Murine Fyn-Related Kinase Length = 121 | Back alignment and structure |
| >pdb|2YSX|A Chain A, Solution Structure Of The Human Ship Sh2 Domain Length = 119 | Back alignment and structure |
| >pdb|2DVJ|A Chain A, Phosphorylated Crk-Ii Length = 230 | Back alignment and structure |
| >pdb|2EYZ|A Chain A, Ct10-Regulated Kinase Isoform Ii Length = 304 | Back alignment and structure |
| >pdb|1AOT|F Chain F, Nmr Structure Of The Fyn Sh2 Domain Complexed With A Phosphotyrosyl Peptide, Minimized Average Structure Length = 106 | Back alignment and structure |
| >pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | Back alignment and structure |
| >pdb|2LCT|A Chain A, Solution Structure Of The Vav1 Sh2 Domain Complexed With A Syk-Derived Doubly Phosphorylated Peptide Length = 107 | Back alignment and structure |
| >pdb|1JWO|A Chain A, Crystal Structure Analysis Of The Sh2 Domain Of The Csk Homologous Kinase Chk Length = 97 | Back alignment and structure |
| >pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 | Back alignment and structure |
| >pdb|2LNW|A Chain A, Identification And Structural Basis For A Novel Interaction Between Vav2 And Arap3 Length = 122 | Back alignment and structure |
| >pdb|2CRH|A Chain A, Solution Structure Of The Sh2 Domain Of Human Proto- Oncogene Protein Vav1 Length = 138 | Back alignment and structure |
| >pdb|2DLZ|A Chain A, Solution Structure Of The Sh2 Domain Of Human Protein Vav-2 Length = 118 | Back alignment and structure |
| >pdb|1MW4|A Chain A, Solution Structure Of The Human Grb7-Sh2 Domain In Complex With A 10 Amino Acid Peptide Py1139 Length = 120 | Back alignment and structure |
| >pdb|3PQZ|A Chain A, Grb7 Sh2 With Peptide Length = 117 | Back alignment and structure |
| >pdb|4F59|A Chain A, Triple Mutant Src Sh2 Domain Length = 112 | Back alignment and structure |
| >pdb|1WQU|A Chain A, Solution Structure Of The Human Fes Sh2 Domain Length = 114 | Back alignment and structure |
| >pdb|4FL3|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 635 | Back alignment and structure |
| >pdb|4FL2|A Chain A, Structural And Biophysical Characterization Of The Syk Activation Switch Length = 636 | Back alignment and structure |
| >pdb|3BKB|A Chain A, Crystal Structure Of Human Feline Sarcoma Viral Oncogene Homologue (V- Fes) Length = 377 | Back alignment and structure |
| >pdb|3CD3|A Chain A, Crystal Structure Of Phosphorylated Human Feline Sarcoma Viral Oncogene Homologue (V-Fes) In Complex With Staurosporine And A Consensus Peptide Length = 377 | Back alignment and structure |
| >pdb|1IJR|A Chain A, Crystal Structure Of Lck Sh2 Complexed With Nonpeptide Phosphotyrosine Mimetic Length = 104 | Back alignment and structure |
| >pdb|1CSY|A Chain A, Syk Tyrosine Kinase C-Terminal Sh2 Domain Complexed With A Phosphopeptidefrom The Gamma Chain Of The High Affinity Immunoglobin G Receptor, Nmr Length = 112 | Back alignment and structure |
| >pdb|1O41|A Chain A, Crystal Structure Of Sh2 In Complex With Ru78300. Length = 108 | Back alignment and structure |
| >pdb|1A81|A Chain A, Crystal Structure Of The Tandem Sh2 Domain Of The Syk Kinase Bound To A Dually Tyrosine-Phosphorylated Itam Length = 254 | Back alignment and structure |
| >pdb|1FBZ|A Chain A, Structure-Based Design Of A Novel, Osteoclast-Selective, Nonpeptide Src Sh2 Inhibitor With In Vivo Anti-Resorptive Activity Length = 104 | Back alignment and structure |
| >pdb|1SHD|A Chain A, Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein Interactions Length = 107 | Back alignment and structure |
| >pdb|3US4|A Chain A, Crystal Structure Of A Sh2 Domain Of A Megakaryocyte-Associated Tyrosine Kinase (Matk) From Homo Sapiens At 1.50 A Resolution Length = 98 | Back alignment and structure |
| >pdb|1LCJ|A Chain A, Sh2 (Src Homology-2) Domain Of Human P56-Lck Tyrosine Kinase Complexed With The 11 Residue Phosphotyrosyl Peptide Epqpyeeipiyl Length = 109 | Back alignment and structure |
| >pdb|1Y57|A Chain A, Structure Of Unphosphorylated C-Src In Complex With An Inhibitor Length = 452 | Back alignment and structure |
| >pdb|1FMK|A Chain A, Crystal Structure Of Human Tyrosine-Protein Kinase C-Src Length = 452 | Back alignment and structure |
| >pdb|4D8K|A Chain A, Crystal Structure Of A Sh3-Sh2 Domains Of A Lymphocyte-Specific Protein Tyrosine Kinase (Lck) From Homo Sapiens At 2.36 A Resolution Length = 175 | Back alignment and structure |
| >pdb|1BHF|A Chain A, P56lck Sh2 Domain Inhibitor Complex Length = 108 | Back alignment and structure |
| >pdb|1KSW|A Chain A, Structure Of Human C-Src Tyrosine Kinase (Thr338gly Mutant) In Complex With N6-Benzyl Adp Length = 452 | Back alignment and structure |
| >pdb|1O4C|A Chain A, Crystal Structure Of Sh2 In Complex With Phosphate. Length = 108 | Back alignment and structure |
| >pdb|1LKK|A Chain A, Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex With The Phosphotyrosyl Peptide Ac-Ptyr-Glu-Glu-Ile (Pyeei Peptide) Length = 105 | Back alignment and structure |
| >pdb|1CWD|L Chain L, Human P56lck Tyrosine Kinase Complexed With Phosphopeptide Length = 98 | Back alignment and structure |
| >pdb|1BHH|B Chain B, Free P56lck Sh2 Domain Length = 103 | Back alignment and structure |
| >pdb|1LKL|A Chain A, Human P56-Lck Tyrosine Kinase Sh2 Domain In Complex With The Phosphotyrosyl Peptide Ac-Ptyr-Glu-Glu-Gly (Pyeeg Peptide) Length = 104 | Back alignment and structure |
| >pdb|2H8H|A Chain A, Src Kinase In Complex With A Quinazoline Inhibitor Length = 535 | Back alignment and structure |
| >pdb|1A1A|A Chain A, C-Src (Sh2 Domain With C188a Mutation) Complexed With Ace-Formyl Phosphotyr-Glu-(N,N-Dipentyl Amine) Length = 107 | Back alignment and structure |
| >pdb|1F1W|A Chain A, Src Sh2 Thref1trp Mutant Complexed With The Phosphopeptide S(Ptr)vnvqn Length = 104 | Back alignment and structure |
| >pdb|2EKX|A Chain A, Solution Structure Of The Human Bmx Sh2 Domain Length = 110 | Back alignment and structure |
| >pdb|1NZL|A Chain A, Crystal Structure Of Src Sh2 Domain Bound To Doubly Phosphorylated Peptide Pqpyepyipi Length = 103 | Back alignment and structure |
| >pdb|1SHA|A Chain A, Crystal Structure Of The Phosphotyrosine Recognition Domain Sh2 Of V-Src Complexed With Tyrosine-Phosphorylated Peptides Length = 104 | Back alignment and structure |
| >pdb|1IS0|A Chain A, Crystal Structure Of A Complex Of The Src Sh2 Domain With Conformationally Constrained Peptide Inhibitor Length = 106 | Back alignment and structure |
| >pdb|1P13|A Chain A, Crystal Structure Of The Src Sh2 Domain Complexed With Peptide (Sdpyanfk) Length = 102 | Back alignment and structure |
| >pdb|1SKJ|A Chain A, Cocrystal Structure Of Urea-Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|1LCK|A Chain A, Sh3-Sh2 Domain Fragment Of Human P56-Lck Tyrosine Kinase Complexed With The 10 Residue Synthetic Phosphotyrosyl Peptide Tegqpyqpqpa Length = 175 | Back alignment and structure |
| >pdb|1H9O|A Chain A, Phosphatidylinositol 3-Kinase, P85-Alpha Subunit: C-Terminal Sh2 Domain Complexed With A Tyr751 Phosphopeptide From The Pdgf Receptor, Crystal Structure At 1.79 A Length = 112 | Back alignment and structure |
| >pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 | Back alignment and structure |
| >pdb|1X27|A Chain A, Crystal Structure Of Lck Sh2-Sh3 With Sh2 Binding Site Of P130cas Length = 167 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 614 | |||
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 1e-161 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 3e-31 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 7e-29 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 9e-08 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 7e-07 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 1e-140 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 1e-30 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 1e-28 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 4e-10 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 5e-10 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 6e-05 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 1e-137 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 2e-30 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 3e-30 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 3e-10 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 3e-10 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 1e-04 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 1e-105 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 1e-29 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 1e-105 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 4e-26 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 2e-99 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 9e-29 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 9e-99 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 2e-23 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 2e-15 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 2e-98 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 2e-24 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 3e-15 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 5e-98 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 1e-23 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 9e-16 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 6e-98 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 1e-23 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 9e-16 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 1e-97 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 4e-24 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 2e-15 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 2e-97 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 2e-27 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 4e-97 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 6e-27 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 2e-96 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 1e-25 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 2e-15 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 3e-96 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 3e-25 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 3e-15 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 6e-96 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 2e-23 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 8e-95 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 7e-25 | |
| 2pa5_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 1e-94 | |
| 2pa5_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 1e-24 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 1e-94 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 2e-75 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 5e-22 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 7e-22 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 7e-15 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 4e-94 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 4e-24 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 9e-16 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 2e-93 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 2e-25 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 2e-93 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 1e-24 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 2e-15 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 3e-92 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 5e-71 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 5e-22 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 9e-21 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 5e-15 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 1e-91 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 2e-25 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 5e-15 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 3e-91 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 7e-27 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 4e-90 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 2e-77 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 1e-21 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 4e-20 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 8e-15 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 2e-12 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 5e-90 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 3e-25 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 5e-15 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 2e-89 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 3e-75 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 3e-22 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 2e-21 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 8e-15 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 2e-12 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 2e-89 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 6e-27 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 4e-87 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 2e-24 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 3e-86 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 3e-25 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 7e-75 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 7e-19 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 4e-11 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 3e-64 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 1e-19 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 5e-12 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 3e-34 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 4e-34 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 5e-34 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 2e-33 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 3e-33 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 8e-33 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 8e-33 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 1e-32 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 2e-32 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 2e-32 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 4e-04 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 7e-32 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 9e-32 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 4e-13 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 1e-31 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 2e-31 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 3e-31 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 3e-30 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 3e-30 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 4e-30 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 4e-30 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 7e-18 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 4e-30 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 5e-30 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 5e-30 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 6e-30 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 7e-30 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 8e-30 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 8e-30 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 3e-29 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 8e-29 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 1e-28 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 1e-28 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 2e-28 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 2e-28 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 2e-28 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 3e-28 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 5e-28 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 6e-28 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 9e-28 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 2e-27 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 2e-26 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 5e-26 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 3e-23 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 6e-26 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 1e-23 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 8e-26 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 2e-25 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 2e-24 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 2e-24 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 1e-23 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 8e-23 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 2e-22 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 7e-22 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 2e-20 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 2e-19 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 3e-18 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 6e-18 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 6e-18 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 7e-18 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 2e-13 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 8e-18 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 2e-16 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 5e-16 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 1e-15 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 2e-15 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 2e-15 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 9e-15 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 1e-14 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 4e-13 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 3e-12 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 8e-11 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 7e-07 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 1e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 3e-08 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 9e-08 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 2e-07 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 1e-05 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 2e-04 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 2e-06 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 5e-04 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 2e-06 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 8e-06 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 4e-05 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 1e-04 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 6e-04 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 7e-04 |
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
Score = 471 bits (1213), Expect = e-161
Identities = 225/399 (56%), Positives = 268/399 (67%), Gaps = 61/399 (15%)
Query: 210 SIQLGREYTNIRC----DCYDLYGGEKFATLSELVQFYMENQG----------------- 248
S++ T+I+ D YDLYGGEKFATL+ELVQ+YME+ G
Sbjct: 44 SVRRNGAVTHIKIQNTGDYYDLYGGEKFATLAELVQYYMEHHGQLKEKNGDVIELKYPLN 103
Query: 249 ----------------KEAEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDD-------- 284
KEAE+L+ +KGK+GSFLVRESQS PGDFVLSVRT D
Sbjct: 104 CADPTSERWFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDG 163
Query: 285 --KVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPMVETSGTVVHLKQPFNATRITV 342
KVTHVMIRCQ KYDVGGGE+FDSLT L+EHYK+NPMVET GTV+ LKQP N TRI
Sbjct: 164 KSKVTHVMIRCQELKYDVGGGERFDSLTDLVEHYKKNPMVETLGTVLQLKQPLNTTRINA 223
Query: 343 SNIHDRVTELQKE----NSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNIL 398
+ I RV EL K + K GFWEEFE+LQQQE + L++R+EGQ+ +N+NKNRYKNIL
Sbjct: 224 AEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNIL 283
Query: 399 PFDHTRVKLKDVDEDVPGAEYINANYIQSE--------DGGKSYIATQGCLPSTMNDFWS 450
PFDHTRV L D D + P ++YINAN I E KSYIATQGCL +T+NDFW
Sbjct: 284 PFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWR 343
Query: 451 MVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLV 510
MV+QEN RVIVMTTKE+ERGK+KC KYWPD++ K YG + V N+ ES DY LRE +
Sbjct: 344 MVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTLRELKL 403
Query: 511 SKGS--ESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEV 547
SK + R ++ YHF+ WPDHGVPSDPG VL+FL EV
Sbjct: 404 SKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEV 442
|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
| >2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Length = 178 | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} Length = 178 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* Length = 157 | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A Length = 314 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 614 | |||
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 100.0 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 100.0 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 100.0 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 100.0 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 100.0 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 100.0 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 100.0 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 100.0 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 100.0 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 100.0 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 100.0 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 100.0 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 100.0 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 100.0 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 100.0 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 100.0 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 100.0 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 100.0 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 100.0 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 100.0 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 100.0 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 100.0 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 100.0 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 100.0 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 100.0 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 100.0 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 100.0 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 100.0 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 100.0 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 100.0 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 100.0 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 100.0 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 100.0 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 100.0 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 100.0 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 100.0 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 100.0 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 100.0 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 100.0 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 100.0 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.94 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.93 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.93 | |
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 99.89 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 99.87 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 99.87 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 99.87 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 99.86 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 99.86 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 99.86 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 99.85 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 99.85 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 99.85 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 99.85 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 99.85 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 99.84 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 99.84 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 99.84 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 99.84 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 99.84 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 99.84 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 99.84 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 99.84 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 99.84 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 99.84 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 99.84 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 99.84 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 99.84 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 99.83 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 99.83 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 99.82 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 99.82 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 99.81 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 99.81 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 99.81 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 99.8 | |
| 2lnw_A | 122 | VAV-2, guanine nucleotide exchange factor VAV2; si | 99.8 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 99.8 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 99.8 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 99.8 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 99.8 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 99.79 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 99.79 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 99.79 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 99.78 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 99.78 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 99.78 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 99.77 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.77 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 99.77 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 99.77 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 99.77 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 99.77 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 99.77 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 99.77 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 99.77 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.77 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 99.76 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 99.76 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 99.76 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 99.76 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 99.76 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 99.76 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 99.76 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 99.76 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 99.76 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 99.76 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 99.75 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 99.75 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 99.75 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 99.75 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 99.75 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 99.73 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 99.73 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.73 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 99.73 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 99.72 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 99.7 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 99.7 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 99.7 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.69 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 99.68 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.68 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.67 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.67 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.67 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.65 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.65 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.65 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 99.64 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.63 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.6 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 99.59 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.58 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.57 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.54 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.53 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 99.27 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.49 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.47 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.32 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.3 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.27 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 99.25 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.22 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.22 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.22 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.21 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.16 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.16 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.06 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.05 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 98.99 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 98.95 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 98.95 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 98.92 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 98.83 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 98.82 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 98.75 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 98.71 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 98.61 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 98.5 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 98.49 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 98.38 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 98.37 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 98.27 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 98.27 | |
| 1xri_A | 151 | AT1G05000; structural genomics, protein structure | 98.18 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 98.15 | |
| 1wrm_A | 165 | Dual specificity phosphatase 22; DSP, JNK, hydrola | 98.1 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 98.08 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 98.08 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 98.06 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 98.01 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 98.0 | |
| 3s4e_A | 144 | Dual specificity protein phosphatase 19; PTP, prot | 97.99 | |
| 2r0b_A | 154 | Serine/threonine/tyrosine-interacting protein; str | 97.92 | |
| 2hxp_A | 155 | Dual specificity protein phosphatase 9; human phos | 97.86 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 97.8 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 97.8 | |
| 2nt2_A | 145 | Protein phosphatase slingshot homolog 2; alpha/bet | 97.79 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 97.77 | |
| 2g6z_A | 211 | Dual specificity protein phosphatase 5; alpha/beta | 97.71 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 97.66 | |
| 2esb_A | 188 | Dual specificity protein phosphatase 18; alpha/bet | 97.6 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 97.59 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 97.58 | |
| 2y96_A | 219 | Dual specificity phosphatase DUPD1; hydrolase; 2.3 | 97.54 | |
| 3emu_A | 161 | Leucine rich repeat and phosphatase domain contain | 97.52 | |
| 2j16_A | 182 | SDP-1, tyrosine-protein phosphatase YIL113W; hydro | 97.5 | |
| 2pq5_A | 205 | Dual specificity protein phosphatase 13; hydrolase | 97.22 | |
| 3nme_A | 294 | Ptpkis1 protein, SEX4 glucan phosphatase; dual spe | 96.88 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 96.84 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 96.61 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 96.33 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 94.53 | |
| 1ywf_A | 296 | Phosphotyrosine protein phosphatase PTPB; four str | 94.07 | |
| 3f41_A | 629 | Phytase; tandem repeat, protein tyrosine phosphata | 93.53 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 92.22 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 91.69 | |
| 3op0_A | 323 | Signal transduction protein CBL-C; structural geno | 90.62 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 90.22 | |
| 2f46_A | 156 | Hypothetical protein; structural genomics, joint c | 90.11 | |
| 3bux_B | 329 | E3 ubiquitin-protein ligase CBL; TKB, signal trans | 89.58 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 87.15 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 86.62 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 86.52 |
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-67 Score=593.98 Aligned_cols=362 Identities=53% Similarity=0.911 Sum_probs=315.5
Q ss_pred hhhhhhcccccccC----CcccccCCCcccCChhhhh---------------------------------hhcccCCchH
Q psy8517 208 QKSIQLGREYTNIR----CDCYDLYGGEKFATLSELV---------------------------------QFYMENQGKE 250 (614)
Q Consensus 208 ~~s~~~~~~~~~~~----~~~~~~~~~~~~~~~~e~~---------------------------------~~y~~~~~~e 250 (614)
.+|++.+....|++ ++.+.+.+++.|.++.+++ |||+.+.|.+
T Consensus 40 ~LSv~~~~~v~H~~I~~~~~~~~~~~~~~F~sl~eLv~~y~~~~~~l~~~~g~~i~L~~P~~~~~p~~~~Wy~g~~~r~e 119 (595)
T 3ps5_A 40 SLSVRVGDQVTHIRIQNSGDFYDLYGGEKFATLTELVEYYTQQQGVLQDRDGTIIHLKYPLNCSDPTSERWYHGHMSGGQ 119 (595)
T ss_dssp EEEEEETTEEEEEEEEECSSCEESSSSCCBSSHHHHHHHHHTTSSCCBCSSCCBCCCCCBCCCCCSCCSTTEEESCCHHH
T ss_pred EEEEEECCEEEEEEEEeCCCcEEEecCccccchhhhhhhhccCccccccccccccccccccccccccccccccccCCHHH
Confidence 45666666666665 5666677777787777644 4444455669
Q ss_pred HHHHHHccCCCCcEEEeecCCCCCCeEEEEEeCC---------eEEEEEEeecCCeeecCCCccccCHHHHHHhcccCCe
Q psy8517 251 AEQLILQKGKNGSFLVRESQSKPGDFVLSVRTDD---------KVTHVMIRCQAEKYDVGGGEQFDSLTQLIEHYKRNPM 321 (614)
Q Consensus 251 ae~lL~~~~~~G~FLvR~S~s~~g~~~LSv~~~~---------~v~h~~I~~~~~~~~~~~~~~F~sl~eLV~~y~~~~l 321 (614)
||++|+..+.+|+||||+|++.||+|+||+++++ .|+|++|...+++|++.+...|+||.+||+||+.+++
T Consensus 120 Ae~lL~~~~~~G~FLVR~S~~~~g~y~LSv~~~~~~~~~~~~~~v~H~~I~~~~~~~~~~~~~~F~sl~~LV~~y~~~~l 199 (595)
T 3ps5_A 120 AETLLQAKGEPWTFLVRESLSQPGDFVLSVLSDQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFDSLTDLVEHFKKTGI 199 (595)
T ss_dssp HHHHHHHHCCTTEEEEEECSSSTTCEEEEEEEEEESSSTTSCEEEEEEEEBCGGGCBBSSSSCCBSSHHHHHHHHHHSCB
T ss_pred HHHHHhccCCCceEEEEecCCCCCcEEEEEEECCccccccCCCceEEEEEEEeCCEEEEcCCcCCCCHHHHHHHHhcCCc
Confidence 9999988889999999999999999999999988 8999999998889999998999999999999999999
Q ss_pred ecccCeEEEecCCcccccccccccchHHHHHhhccC----CCCcchHHHHHHhhhcccccccccccccccccCCCCCCCC
Q psy8517 322 VETSGTVVHLKQPFNATRITVSNIHDRVTELQKENS----SKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNI 397 (614)
Q Consensus 322 ~~~~g~~~~L~~P~~~t~~~~~~l~~~~~~l~~~~~----~~~g~~~Ef~~l~~~~~~~~~~~~~~~~~~n~~kNR~~~i 397 (614)
+..+|..+.|+.|++.|++++.++..++.+|.+... +..||.+||+.|...+.....++..+..++|..||||.||
T Consensus 200 ~~~~g~~~~L~~p~~~t~i~a~~l~~~v~~L~~~~~~~~~~~~g~~~Ef~~l~~~~~~~~~~~~~~~~~~N~~KNRy~~i 279 (595)
T 3ps5_A 200 EEASGAFVYLRQPYYATRVNAADIENRVLELNKKQESEDTAKAGFWEEFESLQKQEVKNLHQRLEGQRPENKGKNRYKNI 279 (595)
T ss_dssp CCTTSCCBCCCEECCCCCEEGGGHHHHHHHHHCCCCSSSCCCCHHHHHHHHHHGGGGGCCCCCTGGGCGGGGGGCSCSSC
T ss_pred cccCCcEEEeecccccccccchhhHHHHHHHhhcccccccccchHHHHHHHhhcccccccchhhhccChhhhccCCCCCc
Confidence 999999999999999999999999999999988643 6899999999998876555556677899999999999999
Q ss_pred CCCCCcceeecCCCCCCCCCceeeeeeeccCC-----CCceEEEecCCCCCchhhhhcceeccccceEEeeccccccCcc
Q psy8517 398 LPFDHTRVKLKDVDEDVPGAEYINANYIQSED-----GGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKN 472 (614)
Q Consensus 398 ~p~d~tRV~L~~~~~~~~~~dYINAs~I~g~~-----~~~~yIatQ~Pl~~T~~dFW~mvwe~~~~~IVmLt~~~e~~~~ 472 (614)
+|||+|||+|...+++.+++||||||||+|+. .+++|||||||+++|++|||+||||++|.+|||||++.|.++.
T Consensus 280 ~p~D~sRV~L~~~~~~~~~~dYINAn~I~~~~~~~~~~~~~yIatQgPl~~T~~dFW~MVwe~~~~~IVmLt~~~E~g~~ 359 (595)
T 3ps5_A 280 LPFDHSRVILQGRDSNIPGSDYINANYIKNQLLGPDENAKTYIASQGCLEATVNDFWQMAWQENSRVIVMTTREVEKGRN 359 (595)
T ss_dssp CCCTTTEEECCSCCSSSTTTTEEEEEEEECSSSCTTCCCCEEEEECCCCTTTHHHHHHHHHHTTCCEEEECSCSBSSSSB
T ss_pred CCCcCcEEEecCCCCCCCCCCceEeEEEeccccccccccceEEEcCCCCCchHHHHHHHHHhhcCCeEEECCChhhCCcc
Confidence 99999999999766555779999999999996 4789999999999999999999999999999999999999999
Q ss_pred cccccCCCCCCCeeeecEEEEeEEEeeecCEEEEEEEEEeCC--CCceEEEEeeecCCCCCCCCCChHHHHHHHHHHhhc
Q psy8517 473 KCAKYWPDDHQSKTYGAVCVNNMYESVTTDYILREFLVSKGS--ESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVCVN 550 (614)
Q Consensus 473 kc~~YwP~~~~~~~~g~~~V~~~~~~~~~~~~~r~l~v~~~~--~~~r~v~~~~~~~WPd~gvP~~~~~~l~~i~~V~v~ 550 (614)
||.+|||.+++...||.+.|++.++....+|++|.|.|+..+ +.+|.|+||||++|||+|+|.++..+++|+..| +
T Consensus 360 kc~~YwP~~~~~~~~g~~~V~~~~~~~~~~~~~r~l~v~~~~~~~~~r~V~h~~y~~WPD~gvP~~~~~~l~fl~~v--~ 437 (595)
T 3ps5_A 360 KCVPYWPEVGMQRAYGPYSVTNCGEHDTTEYKLRTLQVSPLDNGDLIREIWHYQYLSWPDHGVPSEPGGVLSFLDQI--N 437 (595)
T ss_dssp SCCCCSCCBTCEEEETTEEEEEEEEEECSSEEEEEEEEEESSCCSCCEEEEEEEECCCCSSSSCSCSHHHHHHHHHH--H
T ss_pred ccccccCCCCCceEcccEEEEEEEEEecCCeEEEEEEEeccCCCCceEEEEEEEECCcccCCccCCHHHHHHHHHHH--H
Confidence 999999998778889999999999999999999999999865 678999999999999999999999999999998 5
Q ss_pred cccccc-cccceeEEEeecCCCCC
Q psy8517 551 NMYESV-TTDYILREFLVSKGSES 573 (614)
Q Consensus 551 ~~~e~~-~~~~ilR~~~~s~~~~~ 573 (614)
..+... ....++. +|++|.|.
T Consensus 438 ~~~~~~~~~~PivV--HCsaGvGR 459 (595)
T 3ps5_A 438 QRQESLPHAGPIIV--HSSAGIGR 459 (595)
T ss_dssp HHHHHCTTCCCEEE--ECSSSSHH
T ss_pred HHHhhcCCCCCEEE--EcCCCCch
Confidence 543321 2233443 67777653
|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A | Back alignment and structure |
|---|
| >2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >1xri_A AT1G05000; structural genomics, protein structure initiative, CESG for eukaryotic structural genomics, phosphoprote phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3s4e_A Dual specificity protein phosphatase 19; PTP, protein tyrosine phosphatase, hydrolase; 1.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 3lj8_A 1mkp_A | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >2y96_A Dual specificity phosphatase DUPD1; hydrolase; 2.38A {Homo sapiens} | Back alignment and structure |
|---|
| >3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A | Back alignment and structure |
|---|
| >3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* | Back alignment and structure |
|---|
| >3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2f46_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.41A {Neisseria meningitidis Z2491} | Back alignment and structure |
|---|
| >3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 614 | ||||
| d2shpa1 | 307 | c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( | 6e-66 | |
| d2shpa1 | 307 | c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( | 3e-19 | |
| d1fpra_ | 284 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 4e-58 | |
| d1fpra_ | 284 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 3e-17 | |
| d1lara1 | 317 | c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie | 9e-55 | |
| d1lara1 | 317 | c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie | 2e-08 | |
| d2f71a1 | 297 | c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho | 3e-54 | |
| d2f71a1 | 297 | c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho | 2e-12 | |
| d1rpma_ | 278 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 5e-51 | |
| d1rpma_ | 278 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 2e-11 | |
| d1rpma_ | 278 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 1e-05 | |
| d1l8ka_ | 273 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 2e-49 | |
| d1l8ka_ | 273 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 2e-09 | |
| d1l8ka_ | 273 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 0.001 | |
| d1yfoa_ | 288 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 7e-49 | |
| d1yfoa_ | 288 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 5e-12 | |
| d1yfoa_ | 288 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 3e-06 | |
| d1lyva_ | 283 | c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c | 2e-48 | |
| d1lyva_ | 283 | c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c | 2e-11 | |
| d1p15a_ | 245 | c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { | 9e-48 | |
| d1p15a_ | 245 | c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { | 1e-10 | |
| d1p15a_ | 245 | c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { | 1e-04 | |
| d1jlna_ | 297 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 9e-47 | |
| d1jlna_ | 297 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 1e-11 | |
| d1jlna_ | 297 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 2e-04 | |
| d1lara2 | 249 | c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie | 4e-46 | |
| d1lara2 | 249 | c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie | 1e-12 | |
| d1lara2 | 249 | c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie | 1e-05 | |
| d1lara2 | 249 | c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie | 1e-05 | |
| d1g4us2 | 243 | c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca | 6e-46 | |
| d1g4us2 | 243 | c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca | 1e-10 | |
| d1g4us2 | 243 | c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca | 2e-04 | |
| d1wcha_ | 308 | c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re | 9e-46 | |
| d1wcha_ | 308 | c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re | 1e-13 | |
| d1wcha_ | 308 | c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re | 7e-06 | |
| d2shpa3 | 108 | d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu | 1e-26 | |
| d2shpa3 | 108 | d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu | 0.004 | |
| d2shpa2 | 109 | d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma | 2e-24 | |
| d2shpa2 | 109 | d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma | 0.003 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 4e-23 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 0.001 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 2e-22 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 1e-06 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 0.002 | |
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 5e-22 | |
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 0.001 | |
| d1mila_ | 104 | d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap | 9e-22 | |
| d1qada_ | 107 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 2e-20 | |
| d1jwoa_ | 97 | d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho | 2e-20 | |
| d1k9aa2 | 101 | d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( | 5e-20 | |
| d1fu6a_ | 111 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 8e-20 | |
| d1a81a1 | 129 | d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom | 9e-20 | |
| d1nrva_ | 105 | d.93.1.1 (A:) Growth factor receptor-bound protein | 2e-19 | |
| d1i3za_ | 103 | d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat | 2e-19 | |
| d2qmsa1 | 113 | d.93.1.1 (A:420-532) Growth factor receptor-bound | 2e-19 | |
| d2oq1a1 | 130 | d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 | 3e-19 | |
| d1d4ta_ | 104 | d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap | 5e-19 | |
| d2eyva1 | 109 | d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo | 8e-19 | |
| d1rpya_ | 86 | d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor | 2e-18 | |
| d1lkka_ | 105 | d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo | 9e-18 | |
| d2fcia1 | 105 | d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B | 3e-17 | |
| d1opka2 | 101 | d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M | 3e-17 | |
| d1rjaa_ | 100 | d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu | 6e-17 | |
| d1o48a_ | 106 | d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s | 7e-17 | |
| d1qcfa2 | 103 | d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H | 7e-17 | |
| d2oq1a2 | 124 | d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 | 8e-17 | |
| d1blja_ | 114 | d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou | 2e-16 | |
| d2c9wa2 | 103 | d.93.1.1 (A:32-134) Suppressor of cytokine signali | 2e-16 | |
| d2izva2 | 112 | d.93.1.1 (A:274-385) Suppressor of cytokine signal | 3e-16 | |
| d1luia_ | 108 | d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou | 5e-16 | |
| d1g83a2 | 104 | d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H | 1e-15 | |
| d1a81a2 | 125 | d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H | 4e-15 | |
| d2cs0a1 | 106 | d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai | 1e-14 | |
| d1xa6a2 | 141 | d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom | 5e-14 | |
| d1uura3 | 131 | d.93.1.1 (A:577-707) STAT homologue {Dictyostelium | 9e-12 | |
| d1bg1a3 | 141 | d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) | 9e-11 | |
| d1fpza_ | 176 | c.45.1.1 (A:) Kinase associated phosphatase (kap) | 1e-07 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 2e-06 | |
| d1d5ra2 | 174 | c.45.1.1 (A:14-187) Phoshphoinositide phosphatase | 1e-04 | |
| d1ywfa1 | 272 | c.45.1.5 (A:4-275) Phosphotyrosine protein phospha | 0.002 | |
| d1ohea2 | 182 | c.45.1.1 (A:199-380) Proline directed phosphatase | 0.004 |
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Higher-molecular-weight phosphotyrosine protein phosphatases domain: Tyrosine phosphatase species: Human (Homo sapiens), shp-2 [TaxId: 9606]
Score = 216 bits (550), Expect = 6e-66
Identities = 130/224 (58%), Positives = 158/224 (70%), Gaps = 14/224 (6%)
Query: 338 TRITVSNIHDRVTELQK----ENSSKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNR 393
TRI + I RV EL K + K GFWEEFE+LQQQE + L++R+EGQ+ +N+NKNR
Sbjct: 1 TRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNR 60
Query: 394 YKNILPFDHTRVKLKDVDEDVPGAEYINANYIQSEDGG--------KSYIATQGCLPSTM 445
YKNILPFDHTRV L D D + P ++YINAN I E KSYIATQGCL +T+
Sbjct: 61 YKNILPFDHTRVVLHDGDPNEPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTV 120
Query: 446 NDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSKTYGAVCVNNMYESVTTDYIL 505
NDFW MV+QEN RVIVMTTKE+ERGK+KC KYWPD++ K YG + V N+ ES DY L
Sbjct: 121 NDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALKEYGVMRVRNVKESAAHDYTL 180
Query: 506 REFLVSK--GSESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEV 547
RE +SK + R ++ YHF+ WPDHGVPSDPG VL+FL EV
Sbjct: 181 RELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEV 224
|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} Length = 176 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 272 | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} Length = 182 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 614 | |||
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 100.0 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 100.0 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 100.0 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 100.0 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 100.0 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 100.0 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 100.0 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 100.0 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 100.0 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 100.0 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 100.0 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 99.87 | |
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 99.86 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 99.86 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 99.86 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 99.85 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 99.85 | |
| d2shpa2 | 109 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.84 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 99.84 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 99.84 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 99.82 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 99.82 | |
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 99.82 | |
| d1opka2 | 101 | Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: | 99.82 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.82 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 99.81 | |
| d2shpa3 | 108 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.8 | |
| d1k9aa2 | 101 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.8 | |
| d1rjaa_ | 100 | Tyrosine-protein kinase 6 (Breast tumor kinase, Br | 99.8 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 99.8 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.8 | |
| d2fcia1 | 105 | Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: | 99.79 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 99.79 | |
| d1qcfa2 | 103 | Hemopoetic cell kinase Hck {Human (Homo sapiens) [ | 99.79 | |
| d1lkka_ | 105 | p56-lck tyrosine kinase {Human (Homo sapiens) [Tax | 99.79 | |
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 99.78 | |
| d1o48a_ | 106 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.78 | |
| d2oq1a2 | 124 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.78 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 99.78 | |
| d1d4ta_ | 104 | The Xlp protein Sap {Human (Homo sapiens) [TaxId: | 99.77 | |
| d1a81a2 | 125 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.77 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 99.77 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 99.76 | |
| d1luia_ | 108 | Itk/tsk protein tyrosine kinase {Mouse (Mus muscul | 99.76 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 99.75 | |
| d1g83a2 | 104 | Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: | 99.75 | |
| d1qada_ | 107 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.75 | |
| d1blja_ | 114 | P55 Blk protein tyrosine kinase {Mouse (Mus muscul | 99.74 | |
| d2izva2 | 112 | Suppressor of cytokine signaling 4, SOCS-4 {Human | 99.74 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 99.72 | |
| d2eyva1 | 109 | Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 | 99.7 | |
| d1fu6a_ | 111 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.69 | |
| d2cs0a1 | 106 | Hematopoietic SH2 domain containing protein HSH2D | 99.67 | |
| d2c9wa2 | 103 | Suppressor of cytokine signaling 2, SOCS-2 {Human | 99.65 | |
| d1xa6a2 | 141 | Beta-chimaerin, N-terminal domain {Human (Homo sap | 99.49 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.02 | |
| d1uura3 | 131 | STAT homologue {Dictyostelium discoideum [TaxId: 4 | 98.99 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 98.99 | |
| d1bg1a3 | 141 | STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | 98.82 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 98.72 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 98.58 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 98.55 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 98.38 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 97.73 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 97.53 | |
| d1mkpa_ | 144 | Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp | 97.36 | |
| d1m3ga_ | 145 | Mapk phosphatase {Human (Homo sapiens), pac-1 [Tax | 97.16 | |
| d1vhra_ | 178 | VH1-related dual-specificity phosphatase, VHR {Hum | 97.14 | |
| d1xria_ | 151 | Putative phosphatase At1g05000 {Thale cress (Arabi | 96.28 | |
| d1bf5a3 | 142 | STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | 93.19 | |
| d1ywfa1 | 272 | Phosphotyrosine protein phosphatase PtpB {Mycobact | 92.24 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 86.27 |
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Higher-molecular-weight phosphotyrosine protein phosphatases domain: Tyrosine phosphatase species: Human (Homo sapiens), shp-2 [TaxId: 9606]
Probab=100.00 E-value=1.4e-46 Score=387.08 Aligned_cols=232 Identities=57% Similarity=0.954 Sum_probs=188.1
Q ss_pred ccccccccchHHHHHhhccC----CCCcchHHHHHHhhhcccccccccccccccccCCCCCCCCCCCCCcceeecCCCCC
Q psy8517 338 TRITVSNIHDRVTELQKENS----SKAGFWEEFESLQQQESRHLFTRREGQKLDNRNKNRYKNILPFDHTRVKLKDVDED 413 (614)
Q Consensus 338 t~~~~~~l~~~~~~l~~~~~----~~~g~~~Ef~~l~~~~~~~~~~~~~~~~~~n~~kNR~~~i~p~d~tRV~L~~~~~~ 413 (614)
|+++++++++++++|.+... ...||.+||+.|.+.......+...+..++|..||||.||+|||+|||+|.+.+++
T Consensus 1 t~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~Ef~~l~~~~~~~~~~~~~~~~~~N~~KNRy~~i~p~D~tRV~L~~~~~~ 80 (307)
T d2shpa1 1 TRINAAEIESRVRELSKLAETTDKVKQGFWEEFETLQQQECKLLYSRKEGQRQENKNKNRYKNILPFDHTRVVLHDGDPN 80 (307)
T ss_dssp SCEEGGGHHHHHHHHHC----------CHHHHHHHHHGGGGGGCCCCHHHHSGGGGGGSSSTTCCCCTTTEEECCC----
T ss_pred CeeeHHHHHHHHHHHHHHhhccchhHHHHHHHHHHhhCcCCCCCcchhhhcChhhhhcCCCCCCCCCcCCEEEccCCCCC
Confidence 56788999999999876443 45789999999987765544556778899999999999999999999999876555
Q ss_pred CCCCceeeeeee--------ccCCCCceEEEecCCCCCchhhhhcceeccccceEEeeccccccCcccccccCCCCCCCe
Q psy8517 414 VPGAEYINANYI--------QSEDGGKSYIATQGCLPSTMNDFWSMVWQENVRVIVMTTKEMERGKNKCAKYWPDDHQSK 485 (614)
Q Consensus 414 ~~~~dYINAs~I--------~g~~~~~~yIatQ~Pl~~T~~dFW~mvwe~~~~~IVmLt~~~e~~~~kc~~YwP~~~~~~ 485 (614)
.+++|||||||| +|+..+++|||||||+++|++|||+||||+++.+|||||+..|.++.+|.+|||.+.+..
T Consensus 81 ~~~~dYINAs~i~~~~~~~~dg~~~~~~yIatQ~Pl~~Ti~dFW~MV~e~~~~~IVmL~~~~E~~~~kc~~YwP~~~~~~ 160 (307)
T d2shpa1 81 EPVSDYINANIIMPEFETKCNNSKPKKSYIATQGCLQNTVNDFWRMVFQENSRVIVMTTKEVERGKSKCVKYWPDEYALK 160 (307)
T ss_dssp ---CCEEEEEEECC-----------CCCEEEECCCCTTTHHHHHHHHHHHTCCEEEECSCSEETTEESCCCCSCCTTCEE
T ss_pred CcccceeeeeeecccccccCCCCCCcceeEEECCCCccchHHHHHHHHhcccceEEeecccccCCcccccccCCCCCCce
Confidence 567899999999 788889999999999999999999999999999999999999999999999999988888
Q ss_pred eeecEEEEeEEEeeecCEEEEEEEEEeCC--CCceEEEEeeecCCCCCCCCCChHHHHHHHHHHhhccccccc-ccccee
Q psy8517 486 TYGAVCVNNMYESVTTDYILREFLVSKGS--ESPRKIYHYHFQAWPDHGVPSDPGCVLNFLYEVCVNNMYESV-TTDYIL 562 (614)
Q Consensus 486 ~~g~~~V~~~~~~~~~~~~~r~l~v~~~~--~~~r~v~~~~~~~WPd~gvP~~~~~~l~~i~~V~v~~~~e~~-~~~~il 562 (614)
.+|.+.|++.++....+|+.|.|.+...+ ..+|.|+||||++|||+|+|.++..+++|+..| +..+... ....++
T Consensus 161 ~~g~~~v~~~~~~~~~~~~~r~l~l~~~~~~~~~r~V~~~~~~~Wpd~~vP~~~~~ll~li~~v--~~~~~~~~~~~Piv 238 (307)
T d2shpa1 161 EYGVMRVRNVKESAAHDYTLRELKLSKVGQGNTERTVWQYHFRTWPDHGVPSDPGGVLDFLEEV--HHKQESIMDAGPVV 238 (307)
T ss_dssp EETTEEEEEEEEEECSSEEEEEEEEEETTEEEEEEEEEEEEECCCCSSSCCSCHHHHHHHHHHH--HHHHHHSTTCCCEE
T ss_pred ecceEEEEEEEEEecCCeEEEEEEEEecCCCCcceEEEEEEeCCCCCCCCCCChHHHHHHHHHH--HHHhhcccCCCCEE
Confidence 89999999999999999999999998865 457999999999999999999999999999999 5544332 222333
Q ss_pred EEEeecCCCCC
Q psy8517 563 REFLVSKGSES 573 (614)
Q Consensus 563 R~~~~s~~~~~ 573 (614)
. +++.|.|+
T Consensus 239 V--HCs~GvgR 247 (307)
T d2shpa1 239 V--HCSAGIGR 247 (307)
T ss_dssp E--ECSSSSHH
T ss_pred E--EeCCCCcH
Confidence 3 56666553
|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1mkpa_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pyst1 (mkp3) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vhra_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xria_ c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywfa1 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase PtpB {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|