Diaphorina citri psyllid: psy8528

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MLSNLAKLASNVVRQNVRSLSTTQRLNHDALFVHRDTKDDNLDVKFEFTPDNKKRAEAIISIYPVGHERAAVIPLLDLAQRQHGWLPISAMHYVADFLNLPKMRVYEVATFYTMFIRKPIGEERIKSILQYHLNWCTTTPCWLRNSDAILEVIKKKCNMMLERQDLEPKDMEQIIDDLKAGKKPAPGPSGYTSGIGSQSGRFCQAREAYHDMTSLTGEPHGPWDSKRDFCIITMIIKTCT
cHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccc
*************************LNHDALFVHRDTKDDNLDVKFEFTPDNKKRAEAIISIYPVGHERAAVIPLLDLAQRQHGWLPISAMHYVADFLNLPKMRVYEVATFYTMFIRKPIGEERIKSILQYHLNWCTTTPCWLRNSDAILEVIKKKCNMMLERQDLEPKDMEQIIDDLKAGKKPAPGPSGYTS***********AREAYHDMTSLTGEPHGPWDSKRDFCIITMIIKTC*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSNLAKLASNVVRQNVRSLSTTQRLNHDALFVHRDTKDDNLDVKFEFTPDNKKRAEAIISIYPVGHERAAVIPLLDLAQRQHGWLPISAMHYVADFLNLPKMRVYEVATFYTMFIRKPIGEERIKSILQYHLNWCTTTPCWLRNSDAILEVIKKKCNMMLERQDLEPKDMEQIIDDLKAGKKPAPGPSGYTSGIGSQSGRFCQAREAYHDMTSLTGEPHGPWDSKRDFCIITMIIKTCT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.confidentQ20719
NADH-quinone oxidoreductase subunit E NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.confidentQ9ZDH5
NADH-quinone oxidoreductase chain 2 NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.confidentP29914

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030964 [CC]NADH dehydrogenase complexprobableGO:0043234, GO:0044425, GO:0016020, GO:0032991, GO:0005575
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0005743 [CC]mitochondrial inner membraneprobableGO:0019866, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.6.-.-Acting on NADH or NADPH.probable
1.6.99.-With other acceptors.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I9V, chain 2
Confidence level:very confident
Coverage over the Query: 48-167
View the alignment between query and template
View the model in PyMOL