Diaphorina citri psyllid: psy8529

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430------

MEYGTLEAGFLALRRGWSINIGGGFHHASETKGGGFCAYADISLLVKLLFQSKSISTAMIVDLDAHQFSDYYFPSAHSIKRKRKVEFLKERKALEDEITSEPQESVVTRPWPIVYRPEYNVHFFKLEKLHPFDSKKWKHIFNYLWKHIFNYLVEAKFITQDNIIEPQEVSEEQLLIAHTEKYLKSLKWSFNVAAISEVCPLVAVPNYFVQKCYLRPMRYHVGGTLEAGFLALRRGWSINIGGGFHHASETKGGGFCAYADISLLVKLLFQSKSISTAMIVDLDAHQGNGYEKDFMNETRIFIMETCITSKAKEAIRCRIELAPYTEDQHYLEKIEAGLERSLRSFCPDIIVYNAGTDVLLNDPLGLLAISPQGIIRRDELVFMKARERRVPIVMLTSGGYLKQTARIIADSILNLADLGLISRPYNIWFIYYTSKT

cccHHHHHHHHHHHHccEEECcccccccccccccccccHcHHHHHHHHHHHHccccEEEEEEccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccEEccccccHHHHHHHccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHcccHHHHHHHHHHcccEEECccccccccccccccccHHcHHHHHHHHHHHccccccEEEEEcccccccHHHHHHcccccEEEEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEECcccccccHHHHHHHHHHHHHcccccccccccccccccccc

MEYGTLEAGFLALRRGWSINIGGGFHHASETKGGGFCAYADISLLVKLLFQSKSISTAMIVDLDAHQFSDYYFPSAHSIKRKRKVEFLKERKALED*ITSE****VVTRPWPIVYRPEYNVHFFKLEKLHPFDSKKWKHIFNYLWKHIFNYLVEAKFITQDNIIEPQEVSEEQLLIAHTEKYLKSLKWSFNVAAISEVCPLVAVPNYFVQKCYLRPMRYHVGGTLEAGFLALRRGWSINIGGGFHHASETKGGGFCAYADISLLVKLLFQSKSISTAMIVDLDAHQGNGYEKDFMNETRIFIMETCITSKAKEAIRCRIELAPYTEDQHYLEKIEAGLERSLRSFCPDIIVYNAGTDVLLNDPLGLLAISPQGIIRRDELVFMKARERRVPIVMLTSGGYLKQTARIIADSILNLADLGLISRPYNIWFIYYTSK*

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Histone deacetylase 11	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.	confident	Q91WA3
Histone deacetylase 11	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.	confident	Q96DB2
Histone deacetylase 2	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.	confident	Q944K3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0008134 [MF]	transcription factor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0000118 [CC]	histone deacetylase complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016575 [BP]	histone deacetylation	probable	GO:0006476, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0035601, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0014003 [BP]	oligodendrocyte development	probable	GO:0032502, GO:0044707, GO:0048856, GO:0021782, GO:0007399, GO:0009987, GO:0048709, GO:0030154, GO:0048468, GO:0042063, GO:0044767, GO:0032501, GO:0044763, GO:0008150, GO:0010001, GO:0048869, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0007417
GO:0017136 [MF]	NAD-dependent histone deacetylase activity	probable	GO:0016787, GO:0019213, GO:0004407, GO:0016810, GO:0016811, GO:0034979, GO:0003824, GO:0003674, GO:0033558

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
3.-.-.-	Hydrolases.	probable
3.5.-.-	Acting on carbon-nitrogen bonds, other than peptide bonds.	probable
3.5.1.-	11-cis-retinol dehydrogenase.	probable
3.5.1.98	Histone deacetylase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EW8, chain A
Confidence level:very confident
Coverage over the Query: 109-435
View the alignment between query and template
View the model in PyMOL

Template: 1C3P, chain A
Confidence level:very confident
Coverage over the Query: 2-83
View the alignment between query and template
View the model in PyMOL