Diaphorina citri psyllid: psy8530


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MVHTWMGDQVDMLEDHLGIIRRDELVFMKARERRVPIVMLTSGGYLKQTARIIADSILNLADLGLISR
cccccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHcccccc
*VHTWMGDQVDMLEDHLGIIRRDELVFMKARERRVPIVMLTSGGYLKQTARIIADSILNLADLGLIS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVHTWMGDQVDMLEDHLGIIRRDELVFMKARERRVPIVMLTSGGYLKQTARIIADSILNLADLGLISR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Histone deacetylase 11 Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.confidentQ96DB2
Histone deacetylase 11 Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.confidentQ91WA3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004407 [MF]histone deacetylase activityprobableGO:0016787, GO:0019213, GO:0016810, GO:0016811, GO:0003824, GO:0003674, GO:0033558
GO:0016575 [BP]histone deacetylationprobableGO:0006476, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0035601, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0000118 [CC]histone deacetylase complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZZ1, chain A
Confidence level:confident
Coverage over the Query: 2-61
View the alignment between query and template
View the model in PyMOL