Diaphorina citri psyllid: psy8537


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
MELKVWVEGMQKIVSGVTESTTCQDIVFALAHATGKTGRYTLIERFRNNERLLTPQDHPIKLIKFSHKFTDNTSGGEKSVKTIFISPGWEWKNYAHVSFIST
cEEEEEEccEEEEEEcccccccHHHHHHHHHHHHcccccEEEEEEEccccccccccccHHHHHHHHcccccccccCEEEEccccccccccccccCEEEEEEc
MELKVWVEGMQKIVSGVTESTTCQDIVFALAHATGKTGRYTLIERFRNNERLLTPQDHPIKLIKFSHKFTDNTSGGEKSVKTIFISPGWEWKNYAHVSFIS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MELKVWVEGMQKIVSGVTESTTCQDIVFALAHATGKTGRYTLIERFRNNERLLTPQDHPIKLIKFSHKFTDNTSGGEKSVKTIFISPGWEWKNYAHVSFIST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ras association domain-containing protein 8 confidentQ8NHQ8
Ras association domain-containing protein 8 confidentQ8CJ96

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0048749 [BP]compound eye developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0001654, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0040015 [BP]negative regulation of multicellular organism growthprobableGO:0045926, GO:0040014, GO:0040008, GO:0051241, GO:0008150, GO:0065007, GO:0051239, GO:0048519, GO:0050789
GO:0033227 [BP]dsRNA transportprobableGO:0015931, GO:0050658, GO:0051234, GO:0006810, GO:0050657, GO:0071705, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0051236, GO:0006403, GO:0051179, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CS4, chain A
Confidence level:very confident
Coverage over the Query: 1-80
View the alignment between query and template
View the model in PyMOL