Diaphorina citri psyllid: psy853

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----

MLRPGWLIISKLKANSLSIRNTLPPSQVLSSGAHGGGHHVNSSANNVEETRLRSCGSNFCVIGGKGLDNLERPPDSEIYHITGIYLSCIVVATIMIALMVDPLSSGISNKGFKDEDGNDLQKPPMPMVSGTEEEQIPRGKFKMSTKEKWRILKNIGSLSLAFMVQFTAFQGTANLQSSINAKEGLGTVSLSAIYAALVLSCIFVPTFRLTVKWTLCVSMMCYLPYIGFQFYPRFYTLVPAGILVGIGAAPMWAAKATYLTQVGAVYAKLTDQAVDAIIVRFFGFFFLAWQTAELWGNLISSLETVLPDIPEPSQ

cccccHHHHHHHHccccccccccHHHHHccccccccccccccccccccHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHcccEEccccEEEEEEcccccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc

**RPGWLIISKLKANSLSIRNTLPPSQVLSS***************VEETRLRSCGSNFCVIGGKGLDNLERPPDSEIYHITGIYLSCIVVATIMIALMVDPL*******************************************EKWRILKNIGSLSLAFMVQFTAFQGTANLQSSINAKEGLGTVSLSAIYAALVLSCIFVPTFRLTVKWTLCVSMMCYLPYIGFQFYPRFYTLVPAGILVGIGAAPMWAAKATYLTQVGAVYAKLTDQAVDAIIVRFFGFFFLAWQTAELWGNLISSLETVL********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
UNC93-like protein		confident	Q9Y115

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3O7Q, chain A
Confidence level:probable
Coverage over the Query: 151-263,274-304
View the alignment between query and template
View the model in PyMOL