Diaphorina citri psyllid: psy8546


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS
ccccccccccccccccccCEEccccccccccccHHHHHcccccCEEcccHHHHHHHHHHHHHHHHccccccccCEEEccccccccccccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHccccc
*MFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAF**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0006527 [BP]arginine catabolic processprobableGO:0044282, GO:0019752, GO:0009063, GO:0006807, GO:0044281, GO:0009065, GO:0009064, GO:0044712, GO:1901575, GO:0006520, GO:0006525, GO:0071704, GO:1901605, GO:1901606, GO:0009987, GO:0044710, GO:0008150, GO:0008152, GO:0043436, GO:0009056, GO:0044248, GO:0044238, GO:1901564, GO:1901565, GO:0006082, GO:0046395, GO:0016054, GO:0044237
GO:0006809 [BP]nitric oxide biosynthetic processprobableGO:0044271, GO:0009987, GO:0009058, GO:0044237, GO:0044249, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:0046209
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0012506 [CC]vesicle membraneprobableGO:0031090, GO:0016020, GO:0044464, GO:0005623, GO:0031988, GO:0005575, GO:0012505, GO:0043227, GO:0043226, GO:0044422, GO:0031982
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0043169 [MF]cation bindingprobableGO:0003674, GO:0005488, GO:0043167
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004517 [MF]nitric-oxide synthase activityprobableGO:0004497, GO:0016709, GO:0016705, GO:0003824, GO:0003674, GO:0016491
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3N5W, chain A
Confidence level:very confident
Coverage over the Query: 1-83,94-123
View the alignment between query and template
View the model in PyMOL
Template: 2FLQ, chain A
Confidence level:very confident
Coverage over the Query: 66-149
View the alignment between query and template
View the model in PyMOL
Template: 3HR4, chain A
Confidence level:very confident
Coverage over the Query: 126-175
View the alignment between query and template
View the model in PyMOL