Psyllid ID: psy8546

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------
MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS
ccccccccccccccccccEEEcccccccccccHHHHHHcccccEEEcccHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHccccc
cEEEEccEEEccccEEcccEHHHHHcHHHHcccccccHHHccccEEcHHHHHHHHHHHHHHHHHHHccccEEcccEHHHHHcHHHHccccHHHcccccccEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEccccHHHHHHHHHHHHHHHHHcc
mmfdcgglqftaapfngwymsteigcrdlcdtkrynicenrnttivDHHSAAEQFMKHYENeqrlrngcpfngwymsteigcrdlcDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS
MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLfgralsrrikATVLyatetgkselyaKKLGELAVKFTSKLFGRALSRRIKATVLyatetgkselyAKKLGELFGHAFHS
MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS
**FDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGH****
*MFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETG***LYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAF**
MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS
MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICENRNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query177 2.2.26 [Sep-21-2011]
Q26240 1174 Nitric oxide synthase, sa N/A N/A 0.994 0.149 0.449 1e-43
B1B557 1097 Nitric oxide synthase-lik N/A N/A 0.966 0.155 0.443 1e-39
O61608 1247 Nitric oxide synthase OS= N/A N/A 0.734 0.104 0.428 1e-37
Q27571 1349 Nitric oxide synthase OS= no N/A 0.734 0.096 0.423 1e-35
P29476 1429 Nitric oxide synthase, br yes N/A 0.920 0.114 0.397 4e-35
Q9Z0J4 1429 Nitric oxide synthase, br yes N/A 0.920 0.114 0.397 4e-35
P29475 1434 Nitric oxide synthase, br yes N/A 0.920 0.113 0.397 4e-35
O19132 1435 Nitric oxide synthase, br yes N/A 0.920 0.113 0.397 8e-35
Q8T8C0 1209 Nitric oxide synthase OS= N/A N/A 0.932 0.136 0.364 2e-32
Q62600 1202 Nitric oxide synthase, en no N/A 0.971 0.143 0.379 3e-30
>sp|Q26240|NOS_RHOPR Nitric oxide synthase, salivary gland OS=Rhodnius prolixus PE=2 SV=1 Back     alignment and function desciption
 Score =  175 bits (444), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 98/218 (44%), Positives = 127/218 (58%), Gaps = 42/218 (19%)

Query: 1   MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICEN-------------------- 40
           MMFDCGGLQFTAAPFNGWYM++EIG R+L DT RYN+ E                     
Sbjct: 317 MMFDCGGLQFTAAPFNGWYMNSEIGSRNLGDTNRYNMLEKIAQKMELDTRTPVTLWKDLA 376

Query: 41  --------------RNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYM-------STE 79
                          N TIVDHHSAAE FMKH ENEQRLR GCP +  ++       +T 
Sbjct: 377 MVEANVAVLHSFQLHNVTIVDHHSAAESFMKHLENEQRLRGGCPADWVWIVPPISGSATP 436

Query: 80  IGCRDLCDTKRAVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELAVKFTSKLF 139
           +  +++ +      +  +          +  V +  +  K + + K++   AVKFTSKLF
Sbjct: 437 VFFQEMANYFLYPGYIYQEDAWKCHEWKEIDVKHGLKKEKRKFHFKQIAR-AVKFTSKLF 495

Query: 140 GRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS 177
           G ALS+RIKAT+L+ATETGKSE+YA+KLG++F HAFHS
Sbjct: 496 GSALSKRIKATILFATETGKSEMYARKLGDIFSHAFHS 533
Produces nitric oxide (NO) which is a messenger molecule with diverse functions throughout the body. The production of NO in the salivary gland is used as a vasodilator for blood sucking.
Rhodnius prolixus (taxid: 13249)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 3EC: 9
>sp|B1B557|NOSL_BOMMO Nitric oxide synthase-like protein OS=Bombyx mori GN=NSL PE=2 SV=1 Back     alignment and function description
>sp|O61608|NOS_ANOST Nitric oxide synthase OS=Anopheles stephensi PE=2 SV=2 Back     alignment and function description
>sp|Q27571|NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster GN=Nos PE=2 SV=3 Back     alignment and function description
>sp|P29476|NOS1_RAT Nitric oxide synthase, brain OS=Rattus norvegicus GN=Nos1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z0J4|NOS1_MOUSE Nitric oxide synthase, brain OS=Mus musculus GN=Nos1 PE=1 SV=1 Back     alignment and function description
>sp|P29475|NOS1_HUMAN Nitric oxide synthase, brain OS=Homo sapiens GN=NOS1 PE=1 SV=2 Back     alignment and function description
>sp|O19132|NOS1_RABIT Nitric oxide synthase, brain OS=Oryctolagus cuniculus GN=NOS1 PE=2 SV=1 Back     alignment and function description
>sp|Q8T8C0|NOS_BOMMO Nitric oxide synthase OS=Bombyx mori GN=NOS PE=2 SV=1 Back     alignment and function description
>sp|Q62600|NOS3_RAT Nitric oxide synthase, endothelial OS=Rattus norvegicus GN=Nos3 PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
383865281 1142 PREDICTED: nitric oxide synthase, saliva 0.994 0.154 0.474 5e-45
307206433 1126 Nitric oxide synthase, salivary gland [H 0.971 0.152 0.475 9e-45
340712063 1143 PREDICTED: nitric oxide synthase, saliva 0.994 0.153 0.479 2e-44
350398737 1143 PREDICTED: nitric oxide synthase, saliva 0.994 0.153 0.479 2e-44
380030474 1143 PREDICTED: nitric oxide synthase, saliva 0.994 0.153 0.479 3e-44
61175210 1143 nitric oxide synthase [Apis mellifera] g 0.994 0.153 0.479 3e-44
221136346 1163 nitric oxide synthase [Gryllus bimaculat 0.988 0.150 0.497 3e-44
322788384 1142 hypothetical protein SINV_03517 [Solenop 0.971 0.150 0.470 3e-44
269847876 1145 nitric oxide synthase [Nasonia vitripenn 0.937 0.144 0.458 4e-44
332021642 1146 Nitric oxide synthase, salivary gland [A 0.971 0.150 0.470 1e-43
>gi|383865281|ref|XP_003708103.1| PREDICTED: nitric oxide synthase, salivary gland-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 126/219 (57%), Gaps = 43/219 (19%)

Query: 1   MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICEN-------------------- 40
           M+FDCGGL+FTAAPFNGWYMSTEIG RDLCD +RYN+ E                     
Sbjct: 280 MVFDCGGLEFTAAPFNGWYMSTEIGARDLCDVQRYNLLETIATHMGLDTRTSTSLWKDKA 339

Query: 41  --------------RNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNG-WYMSTEIGCRDL 85
                         +N TIVDHH+A+E FMKHYENE RLRNGCP +  W +    G    
Sbjct: 340 MIEANVAVLHSFQMKNVTIVDHHTASESFMKHYENEMRLRNGCPADWLWIVPPISGSATP 399

Query: 86  CDTKRAVKFTSKLFGRALSRRIKATVL-------YATETGKSELYAKKLGELAVKFTSKL 138
              +    +  K    A     K  V          ++  + + + K++   AVKFTSKL
Sbjct: 400 VFHQEMALYHLKPSYDAQDPAWKTHVWKKGRDKRSTSKKPRRKFHFKQIAR-AVKFTSKL 458

Query: 139 FGRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS 177
           FGRALSRRIKATVL+ATETG S++YA+KLGEL GHAFHS
Sbjct: 459 FGRALSRRIKATVLFATETGTSQMYAEKLGELLGHAFHS 497

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307206433|gb|EFN84471.1| Nitric oxide synthase, salivary gland [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340712063|ref|XP_003394584.1| PREDICTED: nitric oxide synthase, salivary gland-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350398737|ref|XP_003485294.1| PREDICTED: nitric oxide synthase, salivary gland-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380030474|ref|XP_003698873.1| PREDICTED: nitric oxide synthase, salivary gland-like [Apis florea] Back     alignment and taxonomy information
>gi|61175210|ref|NP_001012980.1| nitric oxide synthase [Apis mellifera] gi|59891393|dbj|BAD89803.1| nitric oxide synthase [Apis mellifera] Back     alignment and taxonomy information
>gi|221136346|dbj|BAH14964.1| nitric oxide synthase [Gryllus bimaculatus] Back     alignment and taxonomy information
>gi|322788384|gb|EFZ14055.1| hypothetical protein SINV_03517 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|269847876|ref|NP_001161704.1| nitric oxide synthase [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332021642|gb|EGI62001.1| Nitric oxide synthase, salivary gland [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query177
FB|FBgn0011676 1349 Nos "Nitric oxide synthase" [D 0.265 0.034 0.851 1e-39
UNIPROTKB|E2RHA7 1437 NOS1 "Uncharacterized protein" 0.779 0.096 0.421 3.5e-33
UNIPROTKB|E1BKI3 1325 NOS1 "Nitric oxide synthase" [ 0.745 0.099 0.434 7.5e-33
UNIPROTKB|J9P395 1465 NOS1 "Uncharacterized protein" 0.745 0.090 0.434 9.7e-33
UNIPROTKB|E1C799 1435 NOS1 "Nitric oxide synthase" [ 0.751 0.092 0.437 1.2e-32
UNIPROTKB|F1RKF2 1433 NOS1 "Nitric oxide synthase" [ 0.745 0.092 0.434 1.2e-32
MGI|MGI:97360 1429 Nos1 "nitric oxide synthase 1, 0.745 0.092 0.434 1.5e-32
RGD|3184 1429 Nos1 "nitric oxide synthase 1, 0.745 0.092 0.434 1.5e-32
UNIPROTKB|P29475 1434 NOS1 "Nitric oxide synthase, b 0.745 0.092 0.434 1.5e-32
UNIPROTKB|F1LQL1 1012 Nos1 "Nitric oxide synthase, b 0.745 0.130 0.427 1.9e-32
FB|FBgn0011676 Nos "Nitric oxide synthase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 196 (74.1 bits), Expect = 1.0e-39, Sum P(3) = 1.0e-39
 Identities = 40/47 (85%), Positives = 44/47 (93%)

Query:   131 AVKFTSKLFGRALSRRIKATVLYATETGKSELYAKKLGELFGHAFHS 177
             AVKFTSKLFGRALS+RIKATVLYATETGKSE YAK+L EL GHAF++
Sbjct:   653 AVKFTSKLFGRALSKRIKATVLYATETGKSEQYAKQLCELLGHAFNA 699
GO:0004517 "nitric-oxide synthase activity" evidence=ISS;IMP;IDA;TAS
GO:0046620 "regulation of organ growth" evidence=TAS
GO:0005516 "calmodulin binding" evidence=IEA;NAS
GO:0008285 "negative regulation of cell proliferation" evidence=TAS
GO:0006809 "nitric oxide biosynthetic process" evidence=IEA;TAS
GO:0007444 "imaginal disc development" evidence=TAS
GO:0008156 "negative regulation of DNA replication" evidence=TAS
GO:0007416 "synapse assembly" evidence=TAS
GO:0020037 "heme binding" evidence=IEA;NAS
GO:0006952 "defense response" evidence=NAS
GO:0005575 "cellular_component" evidence=ND
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0010181 "FMN binding" evidence=IEA
GO:0007399 "nervous system development" evidence=IMP
GO:0005829 "cytosol" evidence=IBA
GO:0007263 "nitric oxide mediated signal transduction" evidence=IBA
GO:0031284 "positive regulation of guanylate cyclase activity" evidence=IBA
GO:0003958 "NADPH-hemoprotein reductase activity" evidence=IBA
UNIPROTKB|E2RHA7 NOS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKI3 NOS1 "Nitric oxide synthase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P395 NOS1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1C799 NOS1 "Nitric oxide synthase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKF2 NOS1 "Nitric oxide synthase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:97360 Nos1 "nitric oxide synthase 1, neuronal" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3184 Nos1 "nitric oxide synthase 1, neuronal" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P29475 NOS1 "Nitric oxide synthase, brain" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQL1 Nos1 "Nitric oxide synthase, brain" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
cd00795412 cd00795, NOS_oxygenase_euk, Nitric oxide synthase 3e-41
pfam02898366 pfam02898, NO_synthase, Nitric oxide synthase, oxy 6e-40
cd00575356 cd00575, NOS_oxygenase, Nitric oxide synthase (NOS 6e-39
cd00794353 cd00794, NOS_oxygenase_prok, Nitric oxide synthase 2e-18
COG4362355 COG4362, COG4362, Nitric oxide synthase, oxygenase 1e-16
cd00795412 cd00795, NOS_oxygenase_euk, Nitric oxide synthase 3e-11
pfam02898366 pfam02898, NO_synthase, Nitric oxide synthase, oxy 4e-11
cd00575356 cd00575, NOS_oxygenase, Nitric oxide synthase (NOS 4e-11
cd00794353 cd00794, NOS_oxygenase_prok, Nitric oxide synthase 2e-07
COG4362355 COG4362, COG4362, Nitric oxide synthase, oxygenase 7e-06
>gnl|CDD|238410 cd00795, NOS_oxygenase_euk, Nitric oxide synthase (NOS) eukaryotic oxygenase domain Back     alignment and domain information 
 Score =  142 bits (361), Expect = 3e-41
 Identities = 50/104 (48%), Positives = 55/104 (52%), Gaps = 34/104 (32%)

Query: 1   MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICEN-------------------- 40
           M+ + GGL+FTA PFNGWYM TEIG RDLCD +RYNI E                     
Sbjct: 271 MLLEIGGLEFTACPFNGWYMGTEIGVRDLCDQQRYNILEEVAKKMGLDTRKTSSLWKDKA 330

Query: 41  --------------RNTTIVDHHSAAEQFMKHYENEQRLRNGCP 70
                          N TIVDHHSA+E FMKH ENE R R GCP
Sbjct: 331 LVEINVAVLHSFQKANVTIVDHHSASESFMKHMENEYRARGGCP 374

NOS produces nitric oxide (NO) by catalyzing a five-electron heme-based oxidation of a guanidine nitrogen of L-arginine to L-citrulline via two successive monooxygenation reactions producing N(omega)-hydroxy-L-arginine (NHA) as an intermediate. In mammals, there are three distinct NOS isozymes: neuronal (nNOS or NOS-1), cytokine-inducible (iNOS or NOS-2) and endothelial (eNOS or NOS-3) . Nitric oxide synthases are homodimers. In eukaryotes, each monomer has an N-terminal oxygenase domain, which binds to the substrate L-Arg, zinc, and to the cofactors heme and 5.6.7.8-(6R)-tetrahydrobiopterin (BH4) . Eukaryotic NOS's also have a C-terminal electron supplying reductase region, which is homologous to cytochrome P450 reductase and binds NADH, FAD and FMN. Length = 412
>gnl|CDD|202456 pfam02898, NO_synthase, Nitric oxide synthase, oxygenase domain Back     alignment and domain information
>gnl|CDD|238321 cd00575, NOS_oxygenase, Nitric oxide synthase (NOS) produces nitric oxide (NO) by catalyzing a five-electron heme-based oxidation of a guanidine nitrogen of L-arginine to L-citrulline via two successive monooxygenation reactions producing N(omega)-hydroxy-L-arginine (NHA) as an intermediate Back     alignment and domain information
>gnl|CDD|238409 cd00794, NOS_oxygenase_prok, Nitric oxide synthase (NOS) prokaryotic oxygenase domain Back     alignment and domain information
>gnl|CDD|226804 COG4362, COG4362, Nitric oxide synthase, oxygenase domain [Inorganic ion transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|238410 cd00795, NOS_oxygenase_euk, Nitric oxide synthase (NOS) eukaryotic oxygenase domain Back     alignment and domain information
>gnl|CDD|202456 pfam02898, NO_synthase, Nitric oxide synthase, oxygenase domain Back     alignment and domain information
>gnl|CDD|238321 cd00575, NOS_oxygenase, Nitric oxide synthase (NOS) produces nitric oxide (NO) by catalyzing a five-electron heme-based oxidation of a guanidine nitrogen of L-arginine to L-citrulline via two successive monooxygenation reactions producing N(omega)-hydroxy-L-arginine (NHA) as an intermediate Back     alignment and domain information
>gnl|CDD|238409 cd00794, NOS_oxygenase_prok, Nitric oxide synthase (NOS) prokaryotic oxygenase domain Back     alignment and domain information
>gnl|CDD|226804 COG4362, COG4362, Nitric oxide synthase, oxygenase domain [Inorganic ion transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 177
cd00795412 NOS_oxygenase_euk Nitric oxide synthase (NOS) euka 100.0
cd00794353 NOS_oxygenase_prok Nitric oxide synthase (NOS) pro 100.0
cd00575356 NOS_oxygenase Nitric oxide synthase (NOS) produces 100.0
PF02898372 NO_synthase: Nitric oxide synthase, oxygenase doma 100.0
COG4362355 Nitric oxide synthase, oxygenase domain [Inorganic 100.0
cd00794353 NOS_oxygenase_prok Nitric oxide synthase (NOS) pro 99.67
cd00575356 NOS_oxygenase Nitric oxide synthase (NOS) produces 99.66
cd00795412 NOS_oxygenase_euk Nitric oxide synthase (NOS) euka 99.64
PF02898372 NO_synthase: Nitric oxide synthase, oxygenase doma 99.56
COG4362355 Nitric oxide synthase, oxygenase domain [Inorganic 99.43
KOG1158|consensus 645 98.06
TIGR01931 597 cysJ sulfite reductase [NADPH] flavoprotein, alpha 94.3
PRK10953 600 cysJ sulfite reductase subunit alpha; Provisional 93.89
>cd00795 NOS_oxygenase_euk Nitric oxide synthase (NOS) eukaryotic oxygenase domain Back     alignment and domain information 
Probab=100.00  E-value=1.6e-54  Score=389.94  Aligned_cols=107  Identities=50%  Similarity=0.882  Sum_probs=105.4

Q ss_pred             CcccccceecccCCcCccccccccccccCCcccccccccC----------------------------------CCceEe
Q psy8546           1 MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICEN----------------------------------RNTTIV   46 (177)
Q Consensus         1 m~l~~gg~~~~a~pfngwym~tEIg~R~~~d~~ryn~l~~----------------------------------~~vti~   46 (177)
                      |+||||||+||||||||||||||||+|||||++||||||.                                  +|||||
T Consensus       271 M~l~iGGi~y~aaPFNGWYM~TEIgaRNl~D~~RYn~L~~VA~~mGlDT~~~~sLWkDrAlvElN~AVLhSF~~~gVtIv  350 (412)
T cd00795         271 MLLEIGGLEFTACPFNGWYMGTEIGVRDLCDQQRYNILEEVAKKMGLDTRKTSSLWKDKALVEINVAVLHSFQKANVTIV  350 (412)
T ss_pred             ceeeeCCEeecCCCcccceechhhhcccccchhhhhhHHHHHHHhCCCCCCCcchhHHHHHHHHHHHHHHHHHHCCceEe
Confidence            8999999999999999999999999999999999999999                                  999999


Q ss_pred             echhHHHHHHHHHHHHhhhcCCCCccceEeeccccccchhhhhhhhhhhhHHHHHhhc-cccccccccccCCC
Q psy8546          47 DHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALS-RRIKATVLYATETG  118 (177)
Q Consensus        47 dhhta~~~f~~~~~~e~~~~~~~P~nw~wm~ppIs~rnf~d~~ry~~lts~lfhk~ma-~rlkptilYqtet~  118 (177)
                      ||||||+|||+|+++|+++||+||+||+|++||+|++          ++ ++||+.|. +.++|+|+||+++|
T Consensus       351 DHHTas~~F~~~~~~E~~~~r~~pgdW~WlvPP~S~s----------~t-pvfH~~~~n~~~~P~f~yq~~~w  412 (412)
T cd00795         351 DHHSASESFMKHMENEYRARGGCPADWVWIVPPMSGS----------IT-PVFHQEMLNYVLSPSYEYQPDPW  412 (412)
T ss_pred             cchHHHHHHHHHHHHHHHhCCCCCCCceeEcCCCCcc----------cc-chhhhhhhccccCCCcccCCCCC
Confidence            9999999999999999999999999999999999999          88 99999999 99999999999887

NOS produces nitric oxide (NO) by catalyzing a five-electron heme-based oxidation of a guanidine nitrogen of L-arginine to L-citrulline via two successive monooxygenation reactions producing N(omega)-hydroxy-L-arginine (NHA) as an intermediate. In mammals, there are three distinct NOS isozymes: neuronal (nNOS or NOS-1), cytokine-inducible (iNOS or NOS-2) and endothelial (eNOS or NOS-3) . Nitric oxide synthases are homodimers. In eukaryotes, each monomer has an N-terminal oxygenase domain, which binds to the substrate L-Arg, zinc, and to the cofactors heme and 5.6.7.8-(6R)-tetrahydrobiopterin (BH4) . Eukaryotic NOS's also have a C-terminal electron supplying reductase region, which is homologous to cytochrome P450 reductase and binds NADH, FAD and FMN.
>cd00794 NOS_oxygenase_prok Nitric oxide synthase (NOS) prokaryotic oxygenase domain Back     alignment and domain information
>cd00575 NOS_oxygenase Nitric oxide synthase (NOS) produces nitric oxide (NO) by catalyzing a five-electron heme-based oxidation of a guanidine nitrogen of L-arginine to L-citrulline via two successive monooxygenation reactions producing N(omega)-hydroxy-L-arginine (NHA) as an intermediate Back     alignment and domain information
>PF02898 NO_synthase: Nitric oxide synthase, oxygenase domain; InterPro: IPR004030 Nitric oxide synthase (1 Back     alignment and domain information
>COG4362 Nitric oxide synthase, oxygenase domain [Inorganic ion transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>cd00794 NOS_oxygenase_prok Nitric oxide synthase (NOS) prokaryotic oxygenase domain Back     alignment and domain information
>cd00575 NOS_oxygenase Nitric oxide synthase (NOS) produces nitric oxide (NO) by catalyzing a five-electron heme-based oxidation of a guanidine nitrogen of L-arginine to L-citrulline via two successive monooxygenation reactions producing N(omega)-hydroxy-L-arginine (NHA) as an intermediate Back     alignment and domain information
>cd00795 NOS_oxygenase_euk Nitric oxide synthase (NOS) eukaryotic oxygenase domain Back     alignment and domain information
>PF02898 NO_synthase: Nitric oxide synthase, oxygenase domain; InterPro: IPR004030 Nitric oxide synthase (1 Back     alignment and domain information
>COG4362 Nitric oxide synthase, oxygenase domain [Inorganic ion transport and metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>KOG1158|consensus Back     alignment and domain information
>TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component Back     alignment and domain information
>PRK10953 cysJ sulfite reductase subunit alpha; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
3dwj_A431 Heme-Proximal W188h Mutant Of Inducible Nitric Oxid 4e-21
3dwj_A431 Heme-Proximal W188h Mutant Of Inducible Nitric Oxid 7e-07
1m8e_A434 Inducible Nitric Oxide Synthase With 7-Nitroindazol 5e-21
1m8e_A434 Inducible Nitric Oxide Synthase With 7-Nitroindazol 8e-07
1qom_A440 Murine Inducible Nitric Oxide Synthase Oxygenase Di 5e-21
1qom_A440 Murine Inducible Nitric Oxide Synthase Oxygenase Di 8e-07
1r35_A433 Murine Inducible Nitric Oxide Synthase Oxygenase Di 5e-21
1r35_A433 Murine Inducible Nitric Oxide Synthase Oxygenase Di 8e-07
1jwj_A433 Murine Inducible Nitric Oxide Synthase Oxygenase Di 5e-21
1jwj_A433 Murine Inducible Nitric Oxide Synthase Oxygenase Di 7e-07
1nod_A423 Murine Inducible Nitric Oxide Synthase Oxygenase Di 5e-21
1nod_A423 Murine Inducible Nitric Oxide Synthase Oxygenase Di 8e-07
1n2n_A419 Crystal Structure Of Cyanide Complex Of The Oxygena 5e-21
1n2n_A419 Crystal Structure Of Cyanide Complex Of The Oxygena 8e-07
1dww_A420 Murine Inducible Nitric Oxide Synthase Oxygenase Di 5e-21
1dww_A420 Murine Inducible Nitric Oxide Synthase Oxygenase Di 8e-07
2bhj_A422 Murine Ino Synthase With Coumarin Inhibitor Length 5e-21
2bhj_A422 Murine Ino Synthase With Coumarin Inhibitor Length 8e-07
2orq_A389 Murine Inducible Nitric Oxide Synthase Oxygenase Do 5e-21
2orq_A389 Murine Inducible Nitric Oxide Synthase Oxygenase Do 7e-07
1dd7_A389 Murine Inducible Nitric Oxide Synthase Oxygenase Do 5e-21
1dd7_A389 Murine Inducible Nitric Oxide Synthase Oxygenase Do 7e-07
1noc_A388 Murine Inducible Nitric Oxide Synthase Oxygenase Do 5e-21
1noc_A388 Murine Inducible Nitric Oxide Synthase Oxygenase Do 7e-07
1jwk_A434 Murine Inducible Nitric Oxide Synthase Oxygenase Di 7e-21
1jwk_A434 Murine Inducible Nitric Oxide Synthase Oxygenase Di 8e-07
3nlh_A444 Structure Of Endothelial Nitric Oxide Synthase Heme 7e-21
3nlh_A444 Structure Of Endothelial Nitric Oxide Synthase Heme 2e-05
3n67_A444 Structure Of Endothelial Nitric Oxide Synthase N368 8e-21
3n67_A444 Structure Of Endothelial Nitric Oxide Synthase N368 2e-05
1zzs_A416 Bovine Enos N368d Single Mutant With L-N(Omega)-Nit 8e-21
1zzs_A416 Bovine Enos N368d Single Mutant With L-N(Omega)-Nit 2e-05
1zzt_A416 Bovine Enos N368dV106M DOUBLE MUTANT WITH L-N(Omega 8e-21
1zzt_A416 Bovine Enos N368dV106M DOUBLE MUTANT WITH L-N(Omega 2e-05
1q2o_A416 Bovine Endothelial Nitric Oxide Synthase N368d Muta 9e-21
1q2o_A416 Bovine Endothelial Nitric Oxide Synthase N368d Muta 2e-05
3nos_A427 Human Endothelial Nitric Oxide Synthase With Argini 2e-20
3nos_A427 Human Endothelial Nitric Oxide Synthase With Argini 9e-05
1m9m_A415 Human Endothelial Nitric Oxide Synthase With 6- Nit 2e-20
1m9m_A415 Human Endothelial Nitric Oxide Synthase With 6- Nit 8e-05
3n6b_A444 Structure Of Endothelial Nitric Oxide Synthase H373 3e-20
3n6b_A444 Structure Of Endothelial Nitric Oxide Synthase H373 7e-05
3e7s_B431 Structure Of Bovine Enos Oxygenase Domain With Inhi 3e-20
3e7s_B431 Structure Of Bovine Enos Oxygenase Domain With Inhi 7e-05
1i83_A444 Bovine Endothelial Nitric Oxide Synthase Heme Domai 3e-20
1i83_A444 Bovine Endothelial Nitric Oxide Synthase Heme Domai 7e-05
1nse_A444 Bovine Endothelial Nitric Oxide Synthase Length = 4 3e-20
1nse_A444 Bovine Endothelial Nitric Oxide Synthase Length = 4 8e-05
3rqo_A443 Structure Of The Endothelial Nitric Oxide Synthase 3e-20
3rqo_A443 Structure Of The Endothelial Nitric Oxide Synthase 8e-05
3e7s_A431 Structure Of Bovine Enos Oxygenase Domain With Inhi 3e-20
3e7s_A431 Structure Of Bovine Enos Oxygenase Domain With Inhi 9e-05
1rs8_A416 Bovine Endothelial Nos Heme Domain With D-Lysine-D- 4e-20
1rs8_A416 Bovine Endothelial Nos Heme Domain With D-Lysine-D- 9e-05
1p6l_A417 Bovine Endothelial Nos Heme Domain With L-N(Omega)- 4e-20
1p6l_A417 Bovine Endothelial Nos Heme Domain With L-N(Omega)- 9e-05
1nsi_A431 Human Inducible Nitric Oxide Synthase, Zn-Bound, L- 8e-20
1nsi_A431 Human Inducible Nitric Oxide Synthase, Zn-Bound, L- 5e-07
3e7g_A424 Structure Of Human Inosox With Inhibitor Ar-C95791 8e-20
3e7g_A424 Structure Of Human Inosox With Inhibitor Ar-C95791 5e-07
3ej8_A424 Structure Of Double Mutant Of Human Inos Oxygenase 8e-20
3ej8_A424 Structure Of Double Mutant Of Human Inos Oxygenase 5e-07
4nos_A427 Human Inducible Nitric Oxide Synthase With Inhibito 9e-20
4nos_A427 Human Inducible Nitric Oxide Synthase With Inhibito 5e-07
1lzx_A419 Rat Neuronal Nos Heme Domain With Ng-Hydroxy-L-Argi 8e-19
1lzx_A419 Rat Neuronal Nos Heme Domain With Ng-Hydroxy-L-Argi 1e-05
2g6h_A420 Structure Of Rat Nnos Heme Domain (Bh4 Bound) In Th 8e-19
2g6h_A420 Structure Of Rat Nnos Heme Domain (Bh4 Bound) In Th 1e-05
1qw6_A420 Rat Neuronal Nitric Oxide Synthase Oxygenase Domain 8e-19
1qw6_A420 Rat Neuronal Nitric Oxide Synthase Oxygenase Domain 1e-05
2g6j_A420 Structure Of Rat Nnos (l337n) Heme Domain (4-aminob 9e-19
2g6j_A420 Structure Of Rat Nnos (l337n) Heme Domain (4-aminob 1e-05
3jws_A422 Structure Of Neuronal Nitric Oxide Synthase R349a M 9e-19
3jws_A422 Structure Of Neuronal Nitric Oxide Synthase R349a M 1e-05
1om5_A421 Structure Of Rat Neuronal Nos Heme Domain With 3-Br 9e-19
1om5_A421 Structure Of Rat Neuronal Nos Heme Domain With 3-Br 1e-05
1om4_A422 Structure Of Rat Neuronal Nos Heme Domain With L-ar 9e-19
1om4_A422 Structure Of Rat Neuronal Nos Heme Domain With L-ar 1e-05
3n65_A422 Structure Of Neuronal Nitric Oxide Synthase S602h M 1e-18
3n65_A422 Structure Of Neuronal Nitric Oxide Synthase S602h M 1e-05
1zzr_A420 Rat Nnos D597nM336V DOUBLE MUTANT WITH L-N(Omega)-N 3e-18
1zzr_A420 Rat Nnos D597nM336V DOUBLE MUTANT WITH L-N(Omega)-N 4e-05
1zzq_A420 Rat Nnos D597n Mutant With L-N(Omega)-Nitroarginine 3e-18
1zzq_A420 Rat Nnos D597n Mutant With L-N(Omega)-Nitroarginine 4e-05
3jx6_A422 Structure Of Neuronal Nitric Oxide Synthase D597nM3 3e-18
3jx6_A422 Structure Of Neuronal Nitric Oxide Synthase D597nM3 4e-05
3dqr_A422 Structure Of Neuronal Nos D597nM336V MUTANT HEME DO 3e-18
3dqr_A422 Structure Of Neuronal Nos D597nM336V MUTANT HEME DO 4e-05
3jx0_A422 Structure Of Rat Neuronal Nitric Oxide Synthase D59 4e-18
3jx0_A422 Structure Of Rat Neuronal Nitric Oxide Synthase D59 4e-05
1p6k_A421 Rat Neuronal Nos D597n Mutant Heme Domain With L-N( 4e-18
1p6k_A421 Rat Neuronal Nos D597n Mutant Heme Domain With L-N( 4e-05
3fc5_A422 G586s Mutant Nnosoxy Length = 422 5e-18
3fc5_A422 G586s Mutant Nnosoxy Length = 422 6e-05
2an0_A361 Crystal Structure Of The P332g Mutant Of The Bacill 4e-12
2an0_A361 Crystal Structure Of The P332g Mutant Of The Bacill 2e-05
1m7z_A361 Structure Of Nitric Oxide Synthase Heme Protein Fro 4e-12
1m7z_A361 Structure Of Nitric Oxide Synthase Heme Protein Fro 2e-05
2fbz_X363 Heme-No Complex In A Bacterial Nitric Oxide Synthas 4e-12
2fbz_X363 Heme-No Complex In A Bacterial Nitric Oxide Synthas 2e-05
2amo_A362 Loose Dimer Of A Bacillus Subtilis Nitric Oxide Syn 4e-12
2amo_A362 Loose Dimer Of A Bacillus Subtilis Nitric Oxide Syn 2e-05
2an2_A360 P332g, A333s Double Mutant Of The Bacillus Subtilis 5e-12
2an2_A360 P332g, A333s Double Mutant Of The Bacillus Subtilis 2e-05
2fc2_A363 No-Heme Complex In A Bacterial Nitric Oxide Synthas 5e-12
2fc2_A363 No-Heme Complex In A Bacterial Nitric Oxide Synthas 2e-05
1tll_A 688 Crystal Structure Of Rat Neuronal Nitric-Oxide Synt 3e-10
2flq_A375 Crystal Structure Of Nitric Oxide Synthase From Geo 1e-09
1mjt_A347 Crystal Structure Of Sanos, A Bacterial Nitric Oxid 3e-08
3hr4_A 219 Human Inos Reductase And Calmodulin Complex Length 3e-05
>pdb|3DWJ|A Chain A, Heme-Proximal W188h Mutant Of Inducible Nitric Oxide Synthase Length = 431 Back     alignment and structure 
Iteration: 1

 Score = 97.1 bits (240), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 59/114 (51%), Gaps = 34/114 (29%)
Query: 1   MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICEN-------------------- 40
           M+ + GGL+F A PFNGWYM TEIG RD CDT+RYNI E                     
Sbjct: 284 MLLEVGGLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRA 343
Query: 41  --------------RNTTIVDHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEI 80
                         +N TI+DHH+A+E FMKH +NE R R GCP +  ++   +
Sbjct: 344 VTEINVAVLHSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCPADWIWLVPPV 397
>pdb|3DWJ|A Chain A, Heme-Proximal W188h Mutant Of Inducible Nitric Oxide Synthase Length = 431 Back     alignment and structure
>pdb|1M8E|A Chain A, Inducible Nitric Oxide Synthase With 7-Nitroindazole Bound Length = 434 Back     alignment and structure
>pdb|1M8E|A Chain A, Inducible Nitric Oxide Synthase With 7-Nitroindazole Bound Length = 434 Back     alignment and structure
>pdb|1QOM|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer (Delta 65) With Swapped N-Terminal Hook Length = 440 Back     alignment and structure
>pdb|1QOM|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer (Delta 65) With Swapped N-Terminal Hook Length = 440 Back     alignment and structure
>pdb|1R35|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer, Tetrahydrobiopterin And 4r-Fluoro-N6-Ethanimidoyl-L-Lysine Length = 433 Back     alignment and structure
>pdb|1R35|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer, Tetrahydrobiopterin And 4r-Fluoro-N6-Ethanimidoyl-L-Lysine Length = 433 Back     alignment and structure
>pdb|1JWJ|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer (delta 65) With W457f Mutation At Tetrahydrobiopterin Binding Site Length = 433 Back     alignment and structure
>pdb|1JWJ|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer (delta 65) With W457f Mutation At Tetrahydrobiopterin Binding Site Length = 433 Back     alignment and structure
>pdb|1NOD|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer (Delta 65) With Tetrahydrobiopterin And Substrate L-Arginine Length = 423 Back     alignment and structure
>pdb|1NOD|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer (Delta 65) With Tetrahydrobiopterin And Substrate L-Arginine Length = 423 Back     alignment and structure
>pdb|1N2N|A Chain A, Crystal Structure Of Cyanide Complex Of The Oxygenase Domain Of Inducible Nitric Oxide Synthase. Length = 419 Back     alignment and structure
>pdb|1N2N|A Chain A, Crystal Structure Of Cyanide Complex Of The Oxygenase Domain Of Inducible Nitric Oxide Synthase. Length = 419 Back     alignment and structure
>pdb|1DWW|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer N-Hydroxyarginine And Dihydrobiopterin Length = 420 Back     alignment and structure
>pdb|1DWW|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer N-Hydroxyarginine And Dihydrobiopterin Length = 420 Back     alignment and structure
>pdb|2BHJ|A Chain A, Murine Ino Synthase With Coumarin Inhibitor Length = 422 Back     alignment and structure
>pdb|2BHJ|A Chain A, Murine Ino Synthase With Coumarin Inhibitor Length = 422 Back     alignment and structure
>pdb|2ORQ|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Domain (Delta 114) 4-(Imidazol-1-Yl)phenol And Piperonylamine Complex Length = 389 Back     alignment and structure
>pdb|2ORQ|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Domain (Delta 114) 4-(Imidazol-1-Yl)phenol And Piperonylamine Complex Length = 389 Back     alignment and structure
>pdb|1DD7|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Domain (Delta 114) (N-[(1,3-Benzodioxol-5-Yl)methyl]-1-[2-(1h- Imidazol-1-Yl)pyrimidin-4-Yl]-4-(Methoxycarbonyl)- Piperazine-2-Acetamide Complex Length = 389 Back     alignment and structure
>pdb|1DD7|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Domain (Delta 114) (N-[(1,3-Benzodioxol-5-Yl)methyl]-1-[2-(1h- Imidazol-1-Yl)pyrimidin-4-Yl]-4-(Methoxycarbonyl)- Piperazine-2-Acetamide Complex Length = 389 Back     alignment and structure
>pdb|1NOC|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Domain (Delta 114) Complexed With Type I E. Coli Chloramphenicol Acetyl Transferase And Imidazole Length = 388 Back     alignment and structure
>pdb|1NOC|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Domain (Delta 114) Complexed With Type I E. Coli Chloramphenicol Acetyl Transferase And Imidazole Length = 388 Back     alignment and structure
>pdb|1JWK|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer (Delta 65) With W457a Mutation At Tetrahydrobiopterin Binding Site Length = 434 Back     alignment and structure
>pdb|1JWK|A Chain A, Murine Inducible Nitric Oxide Synthase Oxygenase Dimer (Delta 65) With W457a Mutation At Tetrahydrobiopterin Binding Site Length = 434 Back     alignment and structure
>pdb|3NLH|A Chain A, Structure Of Endothelial Nitric Oxide Synthase Heme Domain N368d Mutant Complexed With 6-{{(3's,4's)-3'-[2"-(3'''- Fluorophenethylamino)ethoxy]pyrrolidin-4'-Yl}methyl}-4- Methylpyridin- 2-Amine Length = 444 Back     alignment and structure
>pdb|3NLH|A Chain A, Structure Of Endothelial Nitric Oxide Synthase Heme Domain N368d Mutant Complexed With 6-{{(3's,4's)-3'-[2"-(3'''- Fluorophenethylamino)ethoxy]pyrrolidin-4'-Yl}methyl}-4- Methylpyridin- 2-Amine Length = 444 Back     alignment and structure
>pdb|3N67|A Chain A, Structure Of Endothelial Nitric Oxide Synthase N368dV106M DOUBLE Mutant Heme Domain Complexed With 6,6'-(2,2'-(5-Amino-1,3-Phenylene) Bis(Ethane-2,1-Diyl))bis(4-Methylpyridin-2-Amine) Length = 444 Back     alignment and structure
>pdb|3N67|A Chain A, Structure Of Endothelial Nitric Oxide Synthase N368dV106M DOUBLE Mutant Heme Domain Complexed With 6,6'-(2,2'-(5-Amino-1,3-Phenylene) Bis(Ethane-2,1-Diyl))bis(4-Methylpyridin-2-Amine) Length = 444 Back     alignment and structure
>pdb|1ZZS|A Chain A, Bovine Enos N368d Single Mutant With L-N(Omega)-Nitroarginine-(4r)- Amino-L-Proline Amide Bound Length = 416 Back     alignment and structure
>pdb|1ZZS|A Chain A, Bovine Enos N368d Single Mutant With L-N(Omega)-Nitroarginine-(4r)- Amino-L-Proline Amide Bound Length = 416 Back     alignment and structure
>pdb|1ZZT|A Chain A, Bovine Enos N368dV106M DOUBLE MUTANT WITH L-N(Omega)- Nitroarginine-(4r)-Amino-L-Proline Amide Bound Length = 416 Back     alignment and structure
>pdb|1ZZT|A Chain A, Bovine Enos N368dV106M DOUBLE MUTANT WITH L-N(Omega)- Nitroarginine-(4r)-Amino-L-Proline Amide Bound Length = 416 Back     alignment and structure
>pdb|1Q2O|A Chain A, Bovine Endothelial Nitric Oxide Synthase N368d Mutant Heme Domain Dimer With L-N(Omega)-Nitroarginine-2,4-L-Diaminobutyramide Bound Length = 416 Back     alignment and structure
>pdb|1Q2O|A Chain A, Bovine Endothelial Nitric Oxide Synthase N368d Mutant Heme Domain Dimer With L-N(Omega)-Nitroarginine-2,4-L-Diaminobutyramide Bound Length = 416 Back     alignment and structure
>pdb|3NOS|A Chain A, Human Endothelial Nitric Oxide Synthase With Arginine Substrate Length = 427 Back     alignment and structure
>pdb|3NOS|A Chain A, Human Endothelial Nitric Oxide Synthase With Arginine Substrate Length = 427 Back     alignment and structure
>pdb|1M9M|A Chain A, Human Endothelial Nitric Oxide Synthase With 6- Nitroindazole Bound Length = 415 Back     alignment and structure
>pdb|1M9M|A Chain A, Human Endothelial Nitric Oxide Synthase With 6- Nitroindazole Bound Length = 415 Back     alignment and structure
>pdb|3N6B|A Chain A, Structure Of Endothelial Nitric Oxide Synthase H373s Single Mutant Heme Domain Complexed With 6,6'-(2,2'-(Pyridine-3,5-Diyl)bis(Ethane- 2,1-Diyl))bis(4-Methylpyridin-2-Amine) Length = 444 Back     alignment and structure
>pdb|3N6B|A Chain A, Structure Of Endothelial Nitric Oxide Synthase H373s Single Mutant Heme Domain Complexed With 6,6'-(2,2'-(Pyridine-3,5-Diyl)bis(Ethane- 2,1-Diyl))bis(4-Methylpyridin-2-Amine) Length = 444 Back     alignment and structure
>pdb|3E7S|B Chain B, Structure Of Bovine Enos Oxygenase Domain With Inhibitor Ar- C95791 Length = 431 Back     alignment and structure
>pdb|3E7S|B Chain B, Structure Of Bovine Enos Oxygenase Domain With Inhibitor Ar- C95791 Length = 431 Back     alignment and structure
>pdb|1I83|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With N1,N14-Bis((S-Methyl)isothioureido)tetradecane (H4b Free) Length = 444 Back     alignment and structure
>pdb|1I83|A Chain A, Bovine Endothelial Nitric Oxide Synthase Heme Domain Complexed With N1,N14-Bis((S-Methyl)isothioureido)tetradecane (H4b Free) Length = 444 Back     alignment and structure
>pdb|1NSE|A Chain A, Bovine Endothelial Nitric Oxide Synthase Length = 444 Back     alignment and structure
>pdb|1NSE|A Chain A, Bovine Endothelial Nitric Oxide Synthase Length = 444 Back     alignment and structure
>pdb|3RQO|A Chain A, Structure Of The Endothelial Nitric Oxide Synthase Heme Domain In Complex With 6-(((3r,4r)-4-(2-((1s,2r1R,2S)-2-(3-Clorophenyl) Cyclopropylamino)ethoxy)pyrrolidin-3-Yl)methyl)-4- Methylpyridin-2- Amine Length = 443 Back     alignment and structure
>pdb|3RQO|A Chain A, Structure Of The Endothelial Nitric Oxide Synthase Heme Domain In Complex With 6-(((3r,4r)-4-(2-((1s,2r1R,2S)-2-(3-Clorophenyl) Cyclopropylamino)ethoxy)pyrrolidin-3-Yl)methyl)-4- Methylpyridin-2- Amine Length = 443 Back     alignment and structure
>pdb|3E7S|A Chain A, Structure Of Bovine Enos Oxygenase Domain With Inhibitor Ar- C95791 Length = 431 Back     alignment and structure
>pdb|3E7S|A Chain A, Structure Of Bovine Enos Oxygenase Domain With Inhibitor Ar- C95791 Length = 431 Back     alignment and structure
>pdb|1RS8|A Chain A, Bovine Endothelial Nos Heme Domain With D-Lysine-D-Nitroarginine Amide Bound Length = 416 Back     alignment and structure
>pdb|1RS8|A Chain A, Bovine Endothelial Nos Heme Domain With D-Lysine-D-Nitroarginine Amide Bound Length = 416 Back     alignment and structure
>pdb|1P6L|A Chain A, Bovine Endothelial Nos Heme Domain With L-N(Omega)-Nitroarginine-2,4- L-Diaminobutyric Amide Bound Length = 417 Back     alignment and structure
>pdb|1P6L|A Chain A, Bovine Endothelial Nos Heme Domain With L-N(Omega)-Nitroarginine-2,4- L-Diaminobutyric Amide Bound Length = 417 Back     alignment and structure
>pdb|1NSI|A Chain A, Human Inducible Nitric Oxide Synthase, Zn-Bound, L-Arg Complex Length = 431 Back     alignment and structure
>pdb|1NSI|A Chain A, Human Inducible Nitric Oxide Synthase, Zn-Bound, L-Arg Complex Length = 431 Back     alignment and structure
>pdb|3E7G|A Chain A, Structure Of Human Inosox With Inhibitor Ar-C95791 Length = 424 Back     alignment and structure
>pdb|3E7G|A Chain A, Structure Of Human Inosox With Inhibitor Ar-C95791 Length = 424 Back     alignment and structure
>pdb|3EJ8|A Chain A, Structure Of Double Mutant Of Human Inos Oxygenase Domain With Bound Immidazole Length = 424 Back     alignment and structure
>pdb|3EJ8|A Chain A, Structure Of Double Mutant Of Human Inos Oxygenase Domain With Bound Immidazole Length = 424 Back     alignment and structure
>pdb|4NOS|A Chain A, Human Inducible Nitric Oxide Synthase With Inhibitor Length = 427 Back     alignment and structure
>pdb|4NOS|A Chain A, Human Inducible Nitric Oxide Synthase With Inhibitor Length = 427 Back     alignment and structure
>pdb|1LZX|A Chain A, Rat Neuronal Nos Heme Domain With Ng-Hydroxy-L-Arginine Bound Length = 419 Back     alignment and structure
>pdb|1LZX|A Chain A, Rat Neuronal Nos Heme Domain With Ng-Hydroxy-L-Arginine Bound Length = 419 Back     alignment and structure
>pdb|2G6H|A Chain A, Structure Of Rat Nnos Heme Domain (Bh4 Bound) In The Reduced Form Length = 420 Back     alignment and structure
>pdb|2G6H|A Chain A, Structure Of Rat Nnos Heme Domain (Bh4 Bound) In The Reduced Form Length = 420 Back     alignment and structure
>pdb|1QW6|A Chain A, Rat Neuronal Nitric Oxide Synthase Oxygenase Domain In Complex With N- Omega-Propyl-L-Arg. Length = 420 Back     alignment and structure
>pdb|1QW6|A Chain A, Rat Neuronal Nitric Oxide Synthase Oxygenase Domain In Complex With N- Omega-Propyl-L-Arg. Length = 420 Back     alignment and structure
>pdb|2G6J|A Chain A, Structure Of Rat Nnos (l337n) Heme Domain (4-aminobiopterin Bound) Complexed With No Length = 420 Back     alignment and structure
>pdb|2G6J|A Chain A, Structure Of Rat Nnos (l337n) Heme Domain (4-aminobiopterin Bound) Complexed With No Length = 420 Back     alignment and structure
>pdb|3JWS|A Chain A, Structure Of Neuronal Nitric Oxide Synthase R349a Mutant Hem Complexed With N1-[(3' S,4's)-4'-((6"-Amino-4"-Methylpyridi Methyl)pyrrolidin-3'-Yl]-N2-(3'-Fluorophenethyl)ethane- 1,2- Tetrahydrochloride Length = 422 Back     alignment and structure
>pdb|3JWS|A Chain A, Structure Of Neuronal Nitric Oxide Synthase R349a Mutant Hem Complexed With N1-[(3' S,4's)-4'-((6"-Amino-4"-Methylpyridi Methyl)pyrrolidin-3'-Yl]-N2-(3'-Fluorophenethyl)ethane- 1,2- Tetrahydrochloride Length = 422 Back     alignment and structure
>pdb|1OM5|A Chain A, Structure Of Rat Neuronal Nos Heme Domain With 3-Bromo-7- Nitroindazole Bound Length = 421 Back     alignment and structure
>pdb|1OM5|A Chain A, Structure Of Rat Neuronal Nos Heme Domain With 3-Bromo-7- Nitroindazole Bound Length = 421 Back     alignment and structure
>pdb|1OM4|A Chain A, Structure Of Rat Neuronal Nos Heme Domain With L-arginine Bound Length = 422 Back     alignment and structure
>pdb|1OM4|A Chain A, Structure Of Rat Neuronal Nos Heme Domain With L-arginine Bound Length = 422 Back     alignment and structure
>pdb|3N65|A Chain A, Structure Of Neuronal Nitric Oxide Synthase S602h Mutant Heme Domain In Complex With 6,6'-(2,2'-(Pyridine-3,5-Diyl)bis(Ethane-2,1-Diyl)) Bis(4-Methylpyridin-2-Amine) Length = 422 Back     alignment and structure
>pdb|3N65|A Chain A, Structure Of Neuronal Nitric Oxide Synthase S602h Mutant Heme Domain In Complex With 6,6'-(2,2'-(Pyridine-3,5-Diyl)bis(Ethane-2,1-Diyl)) Bis(4-Methylpyridin-2-Amine) Length = 422 Back     alignment and structure
>pdb|1ZZR|A Chain A, Rat Nnos D597nM336V DOUBLE MUTANT WITH L-N(Omega)-Nitroarginine-(4r)- Amino-L-Proline Amide Bound Length = 420 Back     alignment and structure
>pdb|1ZZR|A Chain A, Rat Nnos D597nM336V DOUBLE MUTANT WITH L-N(Omega)-Nitroarginine-(4r)- Amino-L-Proline Amide Bound Length = 420 Back     alignment and structure
>pdb|1ZZQ|A Chain A, Rat Nnos D597n Mutant With L-N(Omega)-Nitroarginine-(4r)- Amino-L-Proline Amide Bound Length = 420 Back     alignment and structure
>pdb|1ZZQ|A Chain A, Rat Nnos D597n Mutant With L-N(Omega)-Nitroarginine-(4r)- Amino-L-Proline Amide Bound Length = 420 Back     alignment and structure
>pdb|3JX6|A Chain A, Structure Of Neuronal Nitric Oxide Synthase D597nM336VY706 Heme Domain Complexed With N1-[(3' R,4' R)-4'-((6"-Amino-4" Methylpyridin-2"-Yl)methyl)pyrrolidin-3'-Yl]-N2-(3'- Fluorop Ethane-1,2-Diamine Tetrahydrochloride Length = 422 Back     alignment and structure
>pdb|3JX6|A Chain A, Structure Of Neuronal Nitric Oxide Synthase D597nM336VY706 Heme Domain Complexed With N1-[(3' R,4' R)-4'-((6"-Amino-4" Methylpyridin-2"-Yl)methyl)pyrrolidin-3'-Yl]-N2-(3'- Fluorop Ethane-1,2-Diamine Tetrahydrochloride Length = 422 Back     alignment and structure
>pdb|3DQR|A Chain A, Structure Of Neuronal Nos D597nM336V MUTANT HEME DOMAIN IN Complex With A Inhibitor (+-)-N1-{cis-4'-[(6"-Aminopyridin- 2"-Yl)methyl]pyrrolidin-3'-Yl}ethane-1,2-Diamine Length = 422 Back     alignment and structure
>pdb|3DQR|A Chain A, Structure Of Neuronal Nos D597nM336V MUTANT HEME DOMAIN IN Complex With A Inhibitor (+-)-N1-{cis-4'-[(6"-Aminopyridin- 2"-Yl)methyl]pyrrolidin-3'-Yl}ethane-1,2-Diamine Length = 422 Back     alignment and structure
>pdb|3JX0|A Chain A, Structure Of Rat Neuronal Nitric Oxide Synthase D597n Mutant Domain In Complex With N1-{(3's,4's)-4'-[(6"-Amino-4"-Methy 2"-Yl)methyl]pyrrolidin-3'-Yl}-N2-(3'- Fluorophenethyl)ethan Diamine Length = 422 Back     alignment and structure
>pdb|3JX0|A Chain A, Structure Of Rat Neuronal Nitric Oxide Synthase D597n Mutant Domain In Complex With N1-{(3's,4's)-4'-[(6"-Amino-4"-Methy 2"-Yl)methyl]pyrrolidin-3'-Yl}-N2-(3'- Fluorophenethyl)ethan Diamine Length = 422 Back     alignment and structure
>pdb|1P6K|A Chain A, Rat Neuronal Nos D597n Mutant Heme Domain With L-N(Omega)- Nitroarginine-2,4-L-Diaminobutyric Amide Bound Length = 421 Back     alignment and structure
>pdb|1P6K|A Chain A, Rat Neuronal Nos D597n Mutant Heme Domain With L-N(Omega)- Nitroarginine-2,4-L-Diaminobutyric Amide Bound Length = 421 Back     alignment and structure
>pdb|3FC5|A Chain A, G586s Mutant Nnosoxy Length = 422 Back     alignment and structure
>pdb|3FC5|A Chain A, G586s Mutant Nnosoxy Length = 422 Back     alignment and structure
>pdb|2AN0|A Chain A, Crystal Structure Of The P332g Mutant Of The Bacillus Subtilis Nos Length = 361 Back     alignment and structure
>pdb|2AN0|A Chain A, Crystal Structure Of The P332g Mutant Of The Bacillus Subtilis Nos Length = 361 Back     alignment and structure
>pdb|1M7Z|A Chain A, Structure Of Nitric Oxide Synthase Heme Protein From Bacillus Subtilis With N-Hydroxy-Arginine And Tetrahydrofolate Bound Length = 361 Back     alignment and structure
>pdb|1M7Z|A Chain A, Structure Of Nitric Oxide Synthase Heme Protein From Bacillus Subtilis With N-Hydroxy-Arginine And Tetrahydrofolate Bound Length = 361 Back     alignment and structure
>pdb|2FBZ|X Chain X, Heme-No Complex In A Bacterial Nitric Oxide Synthase Length = 363 Back     alignment and structure
>pdb|2FBZ|X Chain X, Heme-No Complex In A Bacterial Nitric Oxide Synthase Length = 363 Back     alignment and structure
>pdb|2AMO|A Chain A, Loose Dimer Of A Bacillus Subtilis Nitric Oxide Synthase Length = 362 Back     alignment and structure
>pdb|2AMO|A Chain A, Loose Dimer Of A Bacillus Subtilis Nitric Oxide Synthase Length = 362 Back     alignment and structure
>pdb|2AN2|A Chain A, P332g, A333s Double Mutant Of The Bacillus Subtilis Nitric Oxide Synthase Length = 360 Back     alignment and structure
>pdb|2AN2|A Chain A, P332g, A333s Double Mutant Of The Bacillus Subtilis Nitric Oxide Synthase Length = 360 Back     alignment and structure
>pdb|2FC2|A Chain A, No-Heme Complex In A Bacterial Nitric Oxide Synthase. An Fe(Iii)-No May Cause Nitrosation. Length = 363 Back     alignment and structure
>pdb|2FC2|A Chain A, No-Heme Complex In A Bacterial Nitric Oxide Synthase. An Fe(Iii)-No May Cause Nitrosation. Length = 363 Back     alignment and structure
>pdb|1TLL|A Chain A, Crystal Structure Of Rat Neuronal Nitric-Oxide Synthase Reductase Module At 2.3 A Resolution. Length = 688 Back     alignment and structure
>pdb|2FLQ|A Chain A, Crystal Structure Of Nitric Oxide Synthase From Geobacillus Stearothermophilus (Atcc 12980) Complexed With L-Arginine Length = 375 Back     alignment and structure
>pdb|1MJT|A Chain A, Crystal Structure Of Sanos, A Bacterial Nitric Oxide Synthase Oxygenase Protein, In Complex With Nad+ And Seitu Length = 347 Back     alignment and structure
>pdb|3HR4|A Chain A, Human Inos Reductase And Calmodulin Complex Length = 219 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query177
2flq_A375 Nitric oxide synthase; thermostable enzyme, oxidor 9e-33
2flq_A375 Nitric oxide synthase; thermostable enzyme, oxidor 5e-08
1mjt_A347 Nitric-oxide synthase homolog; sanos, NO, NOS, bac 1e-32
1mjt_A347 Nitric-oxide synthase homolog; sanos, NO, NOS, bac 7e-08
3n5w_A422 Nitric oxide synthase; heme enzyme, substrate inhi 2e-32
3n5w_A422 Nitric oxide synthase; heme enzyme, substrate inhi 1e-07
1m7v_A363 Nitric oxide synthase; pterin oxygenase, bacteria, 2e-32
1m7v_A363 Nitric oxide synthase; pterin oxygenase, bacteria, 1e-07
2ort_A389 Nitric oxide synthase, inducible; L-arginine monoo 2e-32
2ort_A389 Nitric oxide synthase, inducible; L-arginine monoo 1e-07
1d0c_A444 Bovine endothelial nitric oxide synthase heme DOM; 3e-32
1d0c_A444 Bovine endothelial nitric oxide synthase heme DOM; 9e-08
3e7m_A433 Nitric oxide synthase, inducible; NOS, heme, tetra 4e-32
3e7m_A433 Nitric oxide synthase, inducible; NOS, heme, tetra 1e-07
3hr4_A 219 Nitric oxide synthase, inducible; inducible nitric 2e-13
3hr4_A 219 Nitric oxide synthase, inducible; inducible nitric 2e-12
1tll_A 688 Nitric-oxide synthase, brain; reductase module, FM 2e-10
1tll_A 688 Nitric-oxide synthase, brain; reductase module, FM 2e-09
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 1e-05
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 1e-04
3qe2_A 618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 2e-05
3qe2_A 618 CPR, P450R, NADPH--cytochrome P450 reductase; cypo 3e-05
>2flq_A Nitric oxide synthase; thermostable enzyme, oxidoreductase; HET: ARG HEM; 3.20A {Geobacillus stearothermophilus} Length = 375 Back     alignment and structure
 Score =  119 bits (299), Expect = 9e-33
 Identities = 31/104 (29%), Positives = 41/104 (39%), Gaps = 34/104 (32%)

Query: 1   MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICE--------------------- 39
           M  + GG+++ AAPFNGWYM TEIG R+  D  RYN+                       
Sbjct: 226 MCLEIGGIRYMAAPFNGWYMGTEIGARNFADDYRYNMLPKVASCMGLDTNSNASLWKDKA 285

Query: 40  -------------NRNTTIVDHHSAAEQFMKHYENEQRLRNGCP 70
                            +IVDHH+AA QF    + E+       
Sbjct: 286 LVELNIAVLYSYKKAGVSIVDHHTAARQFQLFEQQEKAAGRHVT 329
>2flq_A Nitric oxide synthase; thermostable enzyme, oxidoreductase; HET: ARG HEM; 3.20A {Geobacillus stearothermophilus} Length = 375 Back     alignment and structure
>1mjt_A Nitric-oxide synthase homolog; sanos, NO, NOS, bacterial, MRSA, seitu, oxidoreductase; HET: SUC HEM NAD; 2.40A {Staphylococcus aureus} SCOP: d.174.1.1 Length = 347 Back     alignment and structure
>1mjt_A Nitric-oxide synthase homolog; sanos, NO, NOS, bacterial, MRSA, seitu, oxidoreductase; HET: SUC HEM NAD; 2.40A {Staphylococcus aureus} SCOP: d.174.1.1 Length = 347 Back     alignment and structure
>3n5w_A Nitric oxide synthase; heme enzyme, substrate inhibitor, Zn oxidoreductase, oxidoreductase-oxidoreductase inhibitor COM; HET: HEM XFJ; 1.73A {Rattus norvegicus} PDB: 2hx3_A* 2hx4_A* 3b3m_A* 3b3n_A* 3b3o_A* 3b3p_A* 3hsn_A* 3hso_A* 3hsp_A* 3jt3_A* 3jt4_A* 3jt5_A* 3jt6_A* 3jt7_A* 3jt8_A* 3jt9_A* 3jta_A* 3n2r_A* 3n5v_A* 1om4_A* ... Length = 422 Back     alignment and structure
>3n5w_A Nitric oxide synthase; heme enzyme, substrate inhibitor, Zn oxidoreductase, oxidoreductase-oxidoreductase inhibitor COM; HET: HEM XFJ; 1.73A {Rattus norvegicus} PDB: 2hx3_A* 2hx4_A* 3b3m_A* 3b3n_A* 3b3o_A* 3b3p_A* 3hsn_A* 3hso_A* 3hsp_A* 3jt3_A* 3jt4_A* 3jt5_A* 3jt6_A* 3jt7_A* 3jt8_A* 3jt9_A* 3jta_A* 3n2r_A* 3n5v_A* 1om4_A* ... Length = 422 Back     alignment and structure
>1m7v_A Nitric oxide synthase; pterin oxygenase, bacteria, heme, oxidoreductase; HET: ARG HEM THG; 1.95A {Bacillus subtilis} SCOP: d.174.1.1 PDB: 2fbz_X* 2fc1_A* 1m7z_A* 2fc2_A* 2an0_A* 2amo_A* 2an2_A* Length = 363 Back     alignment and structure
>1m7v_A Nitric oxide synthase; pterin oxygenase, bacteria, heme, oxidoreductase; HET: ARG HEM THG; 1.95A {Bacillus subtilis} SCOP: d.174.1.1 PDB: 2fbz_X* 2fc1_A* 1m7z_A* 2fc2_A* 2an0_A* 2amo_A* 2an2_A* Length = 363 Back     alignment and structure
>2ort_A Nitric oxide synthase, inducible; L-arginine monooxygenase, heme, dimerization, inhibitor, NOS, oxidoreductase; HET: HEM 342; 1.87A {Mus musculus} PDB: 1dd7_A* 2oro_A* 2orq_A* 2orr_A* 2ors_A* 2orp_A* 1nos_A* 1noc_A* 2nos_A* 1df1_A* 1nod_A* 2nod_A* 3nod_A* 3nw2_A* 2bhj_A* 1dwv_A* 1dww_A* 1dwx_A* 1n2n_A* 1qw4_A* ... Length = 389 Back     alignment and structure
>2ort_A Nitric oxide synthase, inducible; L-arginine monooxygenase, heme, dimerization, inhibitor, NOS, oxidoreductase; HET: HEM 342; 1.87A {Mus musculus} PDB: 1dd7_A* 2oro_A* 2orq_A* 2orr_A* 2ors_A* 2orp_A* 1nos_A* 1noc_A* 2nos_A* 1df1_A* 1nod_A* 2nod_A* 3nod_A* 3nw2_A* 2bhj_A* 1dwv_A* 1dww_A* 1dwx_A* 1n2n_A* 1qw4_A* ... Length = 389 Back     alignment and structure
>1d0c_A Bovine endothelial nitric oxide synthase heme DOM; alpha-beta fold, oxidoreductase; HET: HEM INE; 1.65A {Bos taurus} SCOP: d.174.1.1 PDB: 1d0o_A* 1d1v_A* 1d1w_A* 1d1x_A* 1d1y_A* 1dm6_A* 1dm7_A* 1dm8_A* 1dmi_A* 1dmj_A* 1dmk_A* 1ed4_A* 1ed5_A* 1ed6_A* 1foi_A* 1foj_A* 1fol_A* 1foo_A* 1fop_A* 1nse_A* ... Length = 444 Back     alignment and structure
>1d0c_A Bovine endothelial nitric oxide synthase heme DOM; alpha-beta fold, oxidoreductase; HET: HEM INE; 1.65A {Bos taurus} SCOP: d.174.1.1 PDB: 1d0o_A* 1d1v_A* 1d1w_A* 1d1x_A* 1d1y_A* 1dm6_A* 1dm7_A* 1dm8_A* 1dmi_A* 1dmj_A* 1dmk_A* 1ed4_A* 1ed5_A* 1ed6_A* 1foi_A* 1foj_A* 1fol_A* 1foo_A* 1fop_A* 1nse_A* ... Length = 444 Back     alignment and structure
>3e7m_A Nitric oxide synthase, inducible; NOS, heme, tetrahydrobiopterin, oxido calmodulin-binding, FAD, FMN, iron, metal-binding, NADP, oxidoreductase; HET: HEM H4B AT2; 2.00A {Mus musculus} SCOP: d.174.1.1 PDB: 2y37_A* 1r35_A* 3e67_A* 3e68_A* 3e6l_A* 3e6n_A* 3e6o_A* 3e6t_A* 3e7i_A* 3e65_A* 3e7t_A* 3eai_A* 3ebd_A* 3ebf_A* 3nqs_A* 1m8d_A* 1m8e_A* 1m8h_A* 1m8i_A* 1m9t_A* ... Length = 433 Back     alignment and structure
>3e7m_A Nitric oxide synthase, inducible; NOS, heme, tetrahydrobiopterin, oxido calmodulin-binding, FAD, FMN, iron, metal-binding, NADP, oxidoreductase; HET: HEM H4B AT2; 2.00A {Mus musculus} SCOP: d.174.1.1 PDB: 2y37_A* 1r35_A* 3e67_A* 3e68_A* 3e6l_A* 3e6n_A* 3e6o_A* 3e6t_A* 3e7i_A* 3e65_A* 3e7t_A* 3eai_A* 3ebd_A* 3ebf_A* 3nqs_A* 1m8d_A* 1m8e_A* 1m8h_A* 1m8i_A* 1m9t_A* ... Length = 433 Back     alignment and structure
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, alternative splicing, calcium, calmodulin-binding, FAD, FMN, heme, iron, metal-binding; HET: FMN; 2.50A {Homo sapiens} Length = 219 Back     alignment and structure
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, alternative splicing, calcium, calmodulin-binding, FAD, FMN, heme, iron, metal-binding; HET: FMN; 2.50A {Homo sapiens} Length = 219 Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Length = 688 Back     alignment and structure
>1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 Length = 688 Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Length = 682 Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Length = 682 Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Length = 618 Back     alignment and structure
>3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* Length = 618 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
3n5w_A422 Nitric oxide synthase; heme enzyme, substrate inhi 100.0
3e7m_A433 Nitric oxide synthase, inducible; NOS, heme, tetra 100.0
2ort_A389 Nitric oxide synthase, inducible; L-arginine monoo 100.0
1m7v_A363 Nitric oxide synthase; pterin oxygenase, bacteria, 100.0
2flq_A375 Nitric oxide synthase; thermostable enzyme, oxidor 100.0
1d0c_A444 Bovine endothelial nitric oxide synthase heme DOM; 100.0
1mjt_A347 Nitric-oxide synthase homolog; sanos, NO, NOS, bac 100.0
1m7v_A363 Nitric oxide synthase; pterin oxygenase, bacteria, 99.61
3n5w_A422 Nitric oxide synthase; heme enzyme, substrate inhi 99.61
1mjt_A347 Nitric-oxide synthase homolog; sanos, NO, NOS, bac 99.61
3e7m_A433 Nitric oxide synthase, inducible; NOS, heme, tetra 99.61
2flq_A375 Nitric oxide synthase; thermostable enzyme, oxidor 99.6
1d0c_A444 Bovine endothelial nitric oxide synthase heme DOM; 99.58
2ort_A389 Nitric oxide synthase, inducible; L-arginine monoo 99.57
3hr4_A 219 Nitric oxide synthase, inducible; inducible nitric 98.85
3hr4_A 219 Nitric oxide synthase, inducible; inducible nitric 95.78
2o60_B26 CAM, peptide corresponding to calmodulin binding d 95.54
2o60_B26 CAM, peptide corresponding to calmodulin binding d 91.09
2bpo_A 682 CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- 90.43
>3n5w_A Nitric oxide synthase; heme enzyme, substrate inhibitor, Zn oxidoreductase, oxidoreductase-oxidoreductase inhibitor COM; HET: HEM XFJ; 1.73A {Rattus norvegicus} SCOP: d.174.1.1 PDB: 2hx3_A* 2hx4_A* 3b3m_A* 3b3n_A* 3b3o_A* 3b3p_A* 3hsn_A* 3hso_A* 3hsp_A* 3jt3_A* 3jt4_A* 3jt5_A* 3jt6_A* 3jt7_A* 3jt8_A* 3jt9_A* 3jta_A* 3n2r_A* 3n5v_A* 1om4_A* ... Back     alignment and structure
Probab=100.00  E-value=2.6e-56  Score=401.84  Aligned_cols=114  Identities=43%  Similarity=0.830  Sum_probs=111.0

Q ss_pred             CcccccceecccCCcCccccccccccccCCcccccccccC----------------------------------CCceEe
Q psy8546           1 MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICEN----------------------------------RNTTIV   46 (177)
Q Consensus         1 m~l~~gg~~~~a~pfngwym~tEIg~R~~~d~~ryn~l~~----------------------------------~~vti~   46 (177)
                      |+||||||+||||||||||||||||+|||||++|||+||+                                  +|||||
T Consensus       274 M~LeiGGi~y~aaPFNGWYMgTEIG~Rnl~D~~RYN~L~~VA~~mgLdt~~~~sLWkDrAlvElN~AVlhSF~~~gVtIv  353 (422)
T 3n5w_A          274 MLLEIGGLEFSACPFSGWYMGTEIGVRDYCDNSRYNILEEVAKKMDLDMRKTSSLWKDQALVEINIAVLYSFQSDKVTIV  353 (422)
T ss_dssp             EEEEETTEEESCCCEECCEEHHHHHTHHHHSTTTTCCHHHHHHHTTCCCSCGGGCHHHHHHHHHHHHHHHHHHHTTCCEE
T ss_pred             ceeecCceeccCCCcccceeeehhhhhhcccchhhhhHHHHHHHhCcccCCcchhHHHHHHHHHHHHHHHHHHhCCceEe
Confidence            8999999999999999999999999999999999999999                                  999999


Q ss_pred             echhHHHHHHHHHHHHhhhcCCCCccceEeeccccccchhhhhhhhhhhhHHHHHhhc-cccccccccccCCCcchhHHH
Q psy8546          47 DHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALS-RRIKATVLYATETGKSELYAK  125 (177)
Q Consensus        47 dhhta~~~f~~~~~~e~~~~~~~P~nw~wm~ppIs~rnf~d~~ry~~lts~lfhk~ma-~rlkptilYqtet~ks~~wk~  125 (177)
                      ||||||+|||+|+++|.++||+||+||+|++||+|++          +| ++||+.|. +.++|+|+||+++|+.|+|++
T Consensus       354 DHHtas~~F~~~~~~E~~~~r~~p~dW~WlvPP~Sgs----------~T-pvfH~~~~n~~l~P~f~yq~~~w~~h~w~~  422 (422)
T 3n5w_A          354 DHHSATESFIKHMENEYRCRGGCPADWVWIVPPMSGS----------IT-PVFHQEMLNYRLTPSFEYQPDPWNTHVWKG  422 (422)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHSCCCCCHHHHSCSSSGG----------GS-TTTTBCCCBCCCSSEEEECCCGGGTCCC--
T ss_pred             ccchhHHHHHHHHHHHHHhCCCCCCCceeeCCCcccc----------cc-chhhhhccccccCCccccCCcchhhcccCC
Confidence            9999999999999999999999999999999999999          88 99999999 999999999999999999973
>3e7m_A Nitric oxide synthase, inducible; NOS, heme, tetrahydrobiopterin, oxido calmodulin-binding, FAD, FMN, iron, metal-binding, NADP, oxidoreductase; HET: HEM H4B AT2; 2.00A {Mus musculus} SCOP: d.174.1.1 PDB: 2y37_A* 1r35_A* 3e67_A* 3e68_A* 3e6l_A* 3e6n_A* 3e6o_A* 3e6t_A* 3e7i_A* 3e65_A* 3e7t_A* 3eai_A* 3ebd_A* 3ebf_A* 3nqs_A* 1m8d_A* 1m8e_A* 1m8h_A* 1m8i_A* 1m9t_A* ... Back     alignment and structure
>2ort_A Nitric oxide synthase, inducible; L-arginine monooxygenase, heme, dimerization, inhibitor, NOS, oxidoreductase; HET: HEM 342; 1.87A {Mus musculus} PDB: 1dd7_A* 2oro_A* 2orq_A* 2orr_A* 2ors_A* 2orp_A* 1nos_A* 1noc_A* 2nos_A* 1df1_A* 1nod_A* 2nod_A* 3nod_A* 3nw2_A* 2bhj_A* 1dwv_A* 1dww_A* 1dwx_A* 1n2n_A* 1qw4_A* ... Back     alignment and structure
>1m7v_A Nitric oxide synthase; pterin oxygenase, bacteria, heme, oxidoreductase; HET: ARG HEM THG; 1.95A {Bacillus subtilis} SCOP: d.174.1.1 PDB: 2fbz_X* 2fc1_A* 1m7z_A* 2fc2_A* 2an0_A* 2amo_A* 2an2_A* Back     alignment and structure
>2flq_A Nitric oxide synthase; thermostable enzyme, oxidoreductase; HET: ARG HEM; 3.20A {Geobacillus stearothermophilus} Back     alignment and structure
>1d0c_A Bovine endothelial nitric oxide synthase heme DOM; alpha-beta fold, oxidoreductase; HET: HEM INE; 1.65A {Bos taurus} SCOP: d.174.1.1 PDB: 1d0o_A* 1d1v_A* 1d1w_A* 1d1x_A* 1d1y_A* 1dm6_A* 1dm7_A* 1dm8_A* 1dmi_A* 1dmj_A* 1dmk_A* 1ed4_A* 1ed5_A* 1ed6_A* 1foi_A* 1foj_A* 1fol_A* 1foo_A* 1fop_A* 1nse_A* ... Back     alignment and structure
>1mjt_A Nitric-oxide synthase homolog; sanos, NO, NOS, bacterial, MRSA, seitu, oxidoreductase; HET: SUC HEM NAD; 2.40A {Staphylococcus aureus} SCOP: d.174.1.1 Back     alignment and structure
>1m7v_A Nitric oxide synthase; pterin oxygenase, bacteria, heme, oxidoreductase; HET: ARG HEM THG; 1.95A {Bacillus subtilis} SCOP: d.174.1.1 PDB: 2fbz_X* 2fc1_A* 1m7z_A* 2fc2_A* 2an0_A* 2amo_A* 2an2_A* Back     alignment and structure
>3n5w_A Nitric oxide synthase; heme enzyme, substrate inhibitor, Zn oxidoreductase, oxidoreductase-oxidoreductase inhibitor COM; HET: HEM XFJ; 1.73A {Rattus norvegicus} SCOP: d.174.1.1 PDB: 2hx3_A* 2hx4_A* 3b3m_A* 3b3n_A* 3b3o_A* 3b3p_A* 3hsn_A* 3hso_A* 3hsp_A* 3jt3_A* 3jt4_A* 3jt5_A* 3jt6_A* 3jt7_A* 3jt8_A* 3jt9_A* 3jta_A* 3n2r_A* 3n5v_A* 1om4_A* ... Back     alignment and structure
>1mjt_A Nitric-oxide synthase homolog; sanos, NO, NOS, bacterial, MRSA, seitu, oxidoreductase; HET: SUC HEM NAD; 2.40A {Staphylococcus aureus} SCOP: d.174.1.1 Back     alignment and structure
>3e7m_A Nitric oxide synthase, inducible; NOS, heme, tetrahydrobiopterin, oxido calmodulin-binding, FAD, FMN, iron, metal-binding, NADP, oxidoreductase; HET: HEM H4B AT2; 2.00A {Mus musculus} SCOP: d.174.1.1 PDB: 2y37_A* 1r35_A* 3e67_A* 3e68_A* 3e6l_A* 3e6n_A* 3e6o_A* 3e6t_A* 3e7i_A* 3e65_A* 3e7t_A* 3eai_A* 3ebd_A* 3ebf_A* 3nqs_A* 1m8d_A* 1m8e_A* 1m8h_A* 1m8i_A* 1m9t_A* ... Back     alignment and structure
>2flq_A Nitric oxide synthase; thermostable enzyme, oxidoreductase; HET: ARG HEM; 3.20A {Geobacillus stearothermophilus} Back     alignment and structure
>1d0c_A Bovine endothelial nitric oxide synthase heme DOM; alpha-beta fold, oxidoreductase; HET: HEM INE; 1.65A {Bos taurus} SCOP: d.174.1.1 PDB: 1d0o_A* 1d1v_A* 1d1w_A* 1d1x_A* 1d1y_A* 1dm6_A* 1dm7_A* 1dm8_A* 1dmi_A* 1dmj_A* 1dmk_A* 1ed4_A* 1ed5_A* 1ed6_A* 1foi_A* 1foj_A* 1fol_A* 1foo_A* 1fop_A* 1nse_A* ... Back     alignment and structure
>2ort_A Nitric oxide synthase, inducible; L-arginine monooxygenase, heme, dimerization, inhibitor, NOS, oxidoreductase; HET: HEM 342; 1.87A {Mus musculus} PDB: 1dd7_A* 2oro_A* 2orq_A* 2orr_A* 2ors_A* 2orp_A* 1nos_A* 1noc_A* 2nos_A* 1df1_A* 1nod_A* 2nod_A* 3nod_A* 3nw2_A* 2bhj_A* 1dwv_A* 1dww_A* 1dwx_A* 1n2n_A* 1qw4_A* ... Back     alignment and structure
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, CALM binding, FAD, FMN, heme, iron, metal-binding, NADP, oxidore phosphoprotein; HET: FMN; 2.50A {Homo sapiens} Back     alignment and structure
>3hr4_A Nitric oxide synthase, inducible; inducible nitric oxide synthase, NOS, INOS, CALM binding, FAD, FMN, heme, iron, metal-binding, NADP, oxidore phosphoprotein; HET: FMN; 2.50A {Homo sapiens} Back     alignment and structure
>2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 177
d3e7ma1421 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase ox 7e-37
d3e7ma1421 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase ox 8e-11
d1om4a_418 d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenas 8e-37
d1om4a_418 d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenas 9e-11
d1m7va_363 d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenas 9e-37
d1m7va_363 d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenas 2e-10
d1q2oa_416 d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenas 1e-36
d1q2oa_416 d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenas 2e-10
d1mjta_346 d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenas 9e-36
d1mjta_346 d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenas 2e-09
d1tlla2 202 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FM 1e-07
d1tlla2 202 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FM 5e-06
d1yoba1 179 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelan 0.002
d1fuea_ 163 c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [Tax 0.004
d1ja1a2177 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductas 0.004
d2fcra_ 173 c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 0.004
>d3e7ma1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 421 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Nitric oxide (NO) synthase oxygenase domain
superfamily: Nitric oxide (NO) synthase oxygenase domain
family: Nitric oxide (NO) synthase oxygenase domain
domain: Nitric oxide (NO) synthase oxygenase domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  129 bits (326), Expect = 7e-37
 Identities = 46/104 (44%), Positives = 55/104 (52%), Gaps = 34/104 (32%)

Query: 1   MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICEN-------------------- 40
           M+ + GGL+F A PFNGWYM TEIG RD CDT+RYNI E                     
Sbjct: 273 MLLEVGGLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRA 332

Query: 41  --------------RNTTIVDHHSAAEQFMKHYENEQRLRNGCP 70
                         +N TI+DHH+A+E FMKH +NE R R GCP
Sbjct: 333 VTEINVAVLHSFQKQNVTIMDHHTASESFMKHMQNEYRARGGCP 376
>d3e7ma1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 421 Back     information, alignment and structure
>d1om4a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 418 Back     information, alignment and structure
>d1om4a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 418 Back     information, alignment and structure
>d1m7va_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} Length = 363 Back     information, alignment and structure
>d1m7va_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} Length = 363 Back     information, alignment and structure
>d1q2oa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 416 Back     information, alignment and structure
>d1q2oa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 416 Back     information, alignment and structure
>d1mjta_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Staphylococcus aureus [TaxId: 1280]} Length = 346 Back     information, alignment and structure
>d1mjta_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Staphylococcus aureus [TaxId: 1280]} Length = 346 Back     information, alignment and structure
>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 202 Back     information, alignment and structure
>d1tlla2 c.23.5.2 (A:750-951) Nitric oxide (NO) synthase FMN domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 202 Back     information, alignment and structure
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} Length = 179 Back     information, alignment and structure
>d1fuea_ c.23.5.1 (A:) Flavodoxin {Helicobacter pylori [TaxId: 210]} Length = 163 Back     information, alignment and structure
>d1ja1a2 c.23.5.2 (A:63-239) NADPH-cytochrome p450 reductase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 177 Back     information, alignment and structure
>d2fcra_ c.23.5.1 (A:) Flavodoxin {Chondrus crispus [TaxId: 2769]} Length = 173 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query177
d3e7ma1421 Nitric oxide (NO) synthase oxygenase domain {Mouse 100.0
d1om4a_418 Nitric oxide (NO) synthase oxygenase domain {Rat ( 100.0
d1m7va_363 Nitric oxide (NO) synthase oxygenase domain {Bacil 100.0
d1q2oa_416 Nitric oxide (NO) synthase oxygenase domain {Cow ( 100.0
d1mjta_346 Nitric oxide (NO) synthase oxygenase domain {Staph 100.0
d1mjta_346 Nitric oxide (NO) synthase oxygenase domain {Staph 99.61
d1m7va_363 Nitric oxide (NO) synthase oxygenase domain {Bacil 99.61
d3e7ma1421 Nitric oxide (NO) synthase oxygenase domain {Mouse 99.59
d1q2oa_416 Nitric oxide (NO) synthase oxygenase domain {Cow ( 99.59
d1om4a_418 Nitric oxide (NO) synthase oxygenase domain {Rat ( 99.59
>d3e7ma1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Nitric oxide (NO) synthase oxygenase domain
superfamily: Nitric oxide (NO) synthase oxygenase domain
family: Nitric oxide (NO) synthase oxygenase domain
domain: Nitric oxide (NO) synthase oxygenase domain
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=100.00  E-value=2.6e-57  Score=405.00  Aligned_cols=114  Identities=45%  Similarity=0.858  Sum_probs=112.3

Q ss_pred             CcccccceecccCCcCccccccccccccCCcccccccccC----------------------------------CCceEe
Q psy8546           1 MMFDCGGLQFTAAPFNGWYMSTEIGCRDLCDTKRYNICEN----------------------------------RNTTIV   46 (177)
Q Consensus         1 m~l~~gg~~~~a~pfngwym~tEIg~R~~~d~~ryn~l~~----------------------------------~~vti~   46 (177)
                      |+||||||+||||||||||||||||+|||||++||||||.                                  +|||||
T Consensus       273 M~L~iGGi~y~aaPFNGWYM~TEIgaRNl~D~~RYN~L~~VA~~mGLDT~~~~sLWkDrAlvElN~AVLhSF~~~gVtIv  352 (421)
T d3e7ma1         273 MLLEVGGLEFPACPFNGWYMGTEIGVRDFCDTQRYNILEEVGRRMGLETHTLASLWKDRAVTEINVAVLHSFQKQNVTIM  352 (421)
T ss_dssp             CEEEETTEEESCCCEECCEEHHHHHTHHHHSTTTTCCHHHHHHHTTCCTTCGGGTHHHHHHHHHHHHHHHHHHHTTCCEE
T ss_pred             ceeeeCCEeecccCcccceehhhhhhccccChhhhhhHHHHHHHhCCCCCCCchhhHHHHHHHHHHHHHHHHHHCCceEe
Confidence            8999999999999999999999999999999999999999                                  999999


Q ss_pred             echhHHHHHHHHHHHHhhhcCCCCccceEeeccccccchhhhhhhhhhhhHHHHHhhc-cccccccccccCCCcchhHHH
Q psy8546          47 DHHSAAEQFMKHYENEQRLRNGCPFNGWYMSTEIGCRDLCDTKRAVKFTSKLFGRALS-RRIKATVLYATETGKSELYAK  125 (177)
Q Consensus        47 dhhta~~~f~~~~~~e~~~~~~~P~nw~wm~ppIs~rnf~d~~ry~~lts~lfhk~ma-~rlkptilYqtet~ks~~wk~  125 (177)
                      ||||||+|||+|+++|+++||+||+||+|++||||++          +| ++||+.|. +.++|+|+||+++|++|+|++
T Consensus       353 DHHtas~~F~~~~~~E~~~~r~~pgdW~WlvPP~Sgs----------~T-pvfH~~~~n~~l~P~f~yq~~~w~~h~wk~  421 (421)
T d3e7ma1         353 DHHTASESFMKHMQNEYRARGGCPADWIWLVPPVSGS----------IT-PVFHQEMLNYVLSPFYYYQIEPWKTHIWQN  421 (421)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHSCCCCCHHHHSCSSSGG----------GS-GGGGBCCCCCCCSSEEEBCCCHHHHCCCCC
T ss_pred             chHHHHHHHHHHHHHHHHhCCCCCCCceEECCCCccc----------cc-hhHhhhhhccccCCCceecCCcccccccCC
Confidence            9999999999999999999999999999999999999          88 99999999 999999999999999999985
>d1om4a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m7va_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q2oa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mjta_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1mjta_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1m7va_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3e7ma1 d.174.1.1 (A:77-497) Nitric oxide (NO) synthase oxygenase domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q2oa_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1om4a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure