Diaphorina citri psyllid: psy8547


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MVTHPDTNYRQRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQELGTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQEL
ccccccccccccccEEEEEEEEECccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccHHHccccccccccccccccc
********YRQRTPFWCLLDIVPIKNEKREVVLYLASHKDVT***********************PFWCLLDIVPIKNEKREVVLYLASHK************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTHPDTNYRQRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQELGTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQEL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034765 [BP]regulation of ion transmembrane transportprobableGO:0051049, GO:0050794, GO:0065007, GO:0034762, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0043855 [MF]cyclic nucleotide-gated ion channel activityprobableGO:0022891, GO:0022892, GO:0005215, GO:0005216, GO:0015276, GO:0015075, GO:0022857, GO:0015267, GO:0003674, GO:0022836, GO:0022834, GO:0022803, GO:0022839, GO:0022838
GO:0071805 [BP]potassium ion transmembrane transportprobableGO:0006810, GO:0071804, GO:0006813, GO:0006812, GO:0006811, GO:0009987, GO:0015672, GO:0008150, GO:0034220, GO:0044765, GO:0044763, GO:0030001, GO:0051179, GO:0051234, GO:0055085, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1N9L, chain A
Confidence level:very confident
Coverage over the Query: 5-43
View the alignment between query and template
View the model in PyMOL
Template: 3EWK, chain A
Confidence level:confident
Coverage over the Query: 5-92
View the alignment between query and template
View the model in PyMOL
Template: 3P7N, chain A
Confidence level:confident
Coverage over the Query: 59-113
View the alignment between query and template
View the model in PyMOL