Psyllid ID: psy8547


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-----
MVTHPDTNYRQRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQELGTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQEL
ccccccccccccccEEEEEEEEEEccccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccHHHHccccccccccccccccc
ccccccccccccccEEEEEEEcEcccccccEEEEEEEccccHcccccccccccccccccccccccccccHcccccHHHcccEEEEEEEcccccccccEEEccccccccccccccc
mvthpdtnyrqrtpfwclldivpikneKREVVLYLASHkdvtntkmaqmadngegdyedmqelgtpfwclldivpikneKREVVLYLASHkdvtntkmaqmadngegdyedmqel
mvthpdtnyrqrtpfwcLLDIVPIKNEKREVVLYLashkdvtntkMAQMADNGEGDYEDMQELGTPFWCLLDIVPIKNEKREVVLYLashkdvtntkmAQMADNGEGDYEDMQEL
MVTHPDTNYRQRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQELGTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQEL
**********QRTPFWCLLDIVPIKNEKREVVLYLASHKDVT*****************MQELGTPFWCLLDIVPIKNEKREVVLYLASHK************************
********YRQRTPFWCLLDIVPIKNEKREVVLYLASHKDV***********************************KNEKREVVLYL****************************
********YRQRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQELGTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQEL
****PDTNYRQRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNT*********************PFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMA*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTHPDTNYRQRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQELGTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGDYEDMQEL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query115 2.2.26 [Sep-21-2011]
Q9QWS8 1102 Potassium voltage-gated c yes N/A 0.391 0.040 0.622 9e-11
P59111 1102 Potassium voltage-gated c yes N/A 0.391 0.040 0.622 9e-11
Q96L42 1107 Potassium voltage-gated c yes N/A 0.391 0.040 0.622 1e-10
O89047 1087 Potassium voltage-gated c no N/A 0.347 0.036 0.634 4e-10
Q9WVJ0 1087 Potassium voltage-gated c no N/A 0.347 0.036 0.634 4e-10
Q9ULD8 1083 Potassium voltage-gated c no N/A 0.286 0.030 0.705 8e-10
Q9UQ05 1017 Potassium voltage-gated c no N/A 0.478 0.054 0.451 8e-07
Q9R1T9 1017 Potassium voltage-gated c no N/A 0.356 0.040 0.510 7e-06
Q02280 1174 Potassium voltage-gated c no N/A 0.391 0.038 0.4 0.0004
Q920E3 988 Potassium voltage-gated c no N/A 0.373 0.043 0.413 0.0007
>sp|Q9QWS8|KCNH8_RAT Potassium voltage-gated channel subfamily H member 8 OS=Rattus norvegicus GN=Kcnh8 PE=2 SV=2 Back     alignment and function desciption
 Score = 65.5 bits (158), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 37/45 (82%)

Query: 64  GTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGD 108
           G PFWCLLDIVPIKNEK +VVL+LAS KD+T+TK+   +++ + D
Sbjct: 104 GAPFWCLLDIVPIKNEKGDVVLFLASFKDITDTKVKITSEDKKED 148




Pore-forming (alpha) subunit of voltage-gated potassium channel. Elicits a slowly activating, outward rectifying current. Channel properties may be modulated by cAMP and subunit assembly.
Rattus norvegicus (taxid: 10116)
>sp|P59111|KCNH8_MOUSE Potassium voltage-gated channel subfamily H member 8 OS=Mus musculus GN=Kcnh8 PE=2 SV=2 Back     alignment and function description
>sp|Q96L42|KCNH8_HUMAN Potassium voltage-gated channel subfamily H member 8 OS=Homo sapiens GN=KCNH8 PE=2 SV=2 Back     alignment and function description
>sp|O89047|KCNH3_RAT Potassium voltage-gated channel subfamily H member 3 OS=Rattus norvegicus GN=Kcnh3 PE=2 SV=1 Back     alignment and function description
>sp|Q9WVJ0|KCNH3_MOUSE Potassium voltage-gated channel subfamily H member 3 OS=Mus musculus GN=Kcnh3 PE=2 SV=2 Back     alignment and function description
>sp|Q9ULD8|KCNH3_HUMAN Potassium voltage-gated channel subfamily H member 3 OS=Homo sapiens GN=KCNH3 PE=2 SV=2 Back     alignment and function description
>sp|Q9UQ05|KCNH4_HUMAN Potassium voltage-gated channel subfamily H member 4 OS=Homo sapiens GN=KCNH4 PE=2 SV=1 Back     alignment and function description
>sp|Q9R1T9|KCNH4_RAT Potassium voltage-gated channel subfamily H member 4 OS=Rattus norvegicus GN=Kcnh4 PE=2 SV=1 Back     alignment and function description
>sp|Q02280|KCNAE_DROME Potassium voltage-gated channel protein eag OS=Drosophila melanogaster GN=eag PE=1 SV=2 Back     alignment and function description
>sp|Q920E3|KCNH5_MOUSE Potassium voltage-gated channel subfamily H member 5 OS=Mus musculus GN=Kcnh5 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
189240721 900 PREDICTED: similar to AGAP005251-PA [Tri 0.373 0.047 0.790 6e-14
270012947 1034 hypothetical protein TcasGA2_TC004313 [T 0.373 0.041 0.790 8e-14
357608448 1053 hypothetical protein KGM_17508 [Danaus p 0.391 0.042 0.822 1e-13
242006252 770 voltage-gated channel, putative [Pedicul 0.426 0.063 0.725 3e-13
158292882 1196 AGAP005251-PA [Anopheles gambiae str. PE 0.391 0.037 0.777 3e-13
195121032 1324 GI20242 [Drosophila mojavensis] gi|19391 0.391 0.033 0.755 7e-13
328709452 1477 PREDICTED: hypothetical protein LOC10056 0.330 0.025 0.868 7e-13
195584425 632 GD11328 [Drosophila simulans] gi|1941940 0.391 0.071 0.733 1e-12
487736 1284 putative potassium channel subunit [Dros 0.391 0.035 0.733 2e-12
17136946 1284 eag-like K[+] channel [Drosophila melano 0.391 0.035 0.733 2e-12
>gi|189240721|ref|XP_967544.2| PREDICTED: similar to AGAP005251-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 81.6 bits (200), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 34/43 (79%), Positives = 41/43 (95%)

Query: 10  RQRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADN 52
           +  TPFWCLLDIVPIKNEKREVVL+LASHKD+TNTKMA+M+++
Sbjct: 102 KNSTPFWCLLDIVPIKNEKREVVLFLASHKDITNTKMAEMSES 144




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270012947|gb|EFA09395.1| hypothetical protein TcasGA2_TC004313 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357608448|gb|EHJ66015.1| hypothetical protein KGM_17508 [Danaus plexippus] Back     alignment and taxonomy information
>gi|242006252|ref|XP_002423966.1| voltage-gated channel, putative [Pediculus humanus corporis] gi|212507248|gb|EEB11228.1| voltage-gated channel, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|158292882|ref|XP_314166.4| AGAP005251-PA [Anopheles gambiae str. PEST] gi|157017201|gb|EAA09546.4| AGAP005251-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195121032|ref|XP_002005025.1| GI20242 [Drosophila mojavensis] gi|193910093|gb|EDW08960.1| GI20242 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|328709452|ref|XP_003243964.1| PREDICTED: hypothetical protein LOC100568954 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|195584425|ref|XP_002082007.1| GD11328 [Drosophila simulans] gi|194194016|gb|EDX07592.1| GD11328 [Drosophila simulans] Back     alignment and taxonomy information
>gi|487736|gb|AAA62472.1| putative potassium channel subunit [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|17136946|ref|NP_477009.1| eag-like K[+] channel [Drosophila melanogaster] gi|21627052|gb|AAF57772.2| eag-like K[+] channel [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query115
FB|FBgn0011589 1284 Elk "Eag-like K[+] channel" [D 0.391 0.035 0.733 2.5e-12
UNIPROTKB|F8WCG6195 KCNH8 "Potassium voltage-gated 0.391 0.230 0.622 5.8e-11
UNIPROTKB|I3LM9185 LOC100626445 "Uncharacterized 0.304 0.411 0.771 7.4e-11
UNIPROTKB|J9P8R4 433 KCNH8 "Uncharacterized protein 0.391 0.103 0.622 3.9e-10
UNIPROTKB|J9NXB3 546 KCNH3 "Uncharacterized protein 0.356 0.075 0.658 4.6e-10
UNIPROTKB|F1P602 1056 KCNH3 "Uncharacterized protein 0.356 0.038 0.658 1.1e-09
MGI|MGI:2445160 1102 Kcnh8 "potassium voltage-gated 0.478 0.049 0.527 1.2e-09
RGD|2549 1102 Kcnh8 "potassium voltage-gated 0.478 0.049 0.527 1.2e-09
UNIPROTKB|Q9QWS8 1102 Kcnh8 "Potassium voltage-gated 0.478 0.049 0.527 1.2e-09
ZFIN|ZDB-GENE-070912-23 914 kcnh3 "potassium voltage-gated 0.408 0.051 0.645 1.2e-09
FB|FBgn0011589 Elk "Eag-like K[+] channel" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 179 (68.1 bits), Expect = 2.5e-12, P = 2.5e-12
 Identities = 33/45 (73%), Positives = 38/45 (84%)

Query:    64 GTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMADNGEGD 108
             G PFWCL DIVPIKNEKR+VVL+LASHKD+T+TKM +M  N E D
Sbjct:   103 GAPFWCLFDIVPIKNEKRDVVLFLASHKDITHTKMLEMNVNEECD 147


GO:0005267 "potassium channel activity" evidence=NAS
GO:0005249 "voltage-gated potassium channel activity" evidence=IEA;NAS
GO:0008076 "voltage-gated potassium channel complex" evidence=NAS
GO:0006813 "potassium ion transport" evidence=IEA;NAS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0000155 "phosphorelay sensor kinase activity" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0000160 "phosphorelay signal transduction system" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
UNIPROTKB|F8WCG6 KCNH8 "Potassium voltage-gated channel subfamily H member 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LM91 LOC100626445 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9P8R4 KCNH8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXB3 KCNH3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P602 KCNH3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:2445160 Kcnh8 "potassium voltage-gated channel, subfamily H (eag-related), member 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2549 Kcnh8 "potassium voltage-gated channel, subfamily H (eag-related), member 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9QWS8 Kcnh8 "Potassium voltage-gated channel subfamily H member 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070912-23 kcnh3 "potassium voltage-gated channel, subfamily H (eag-related), member 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
smart0008643 smart00086, PAC, Motif C-terminal to PAS motifs (l 2e-05
pfam13426101 pfam13426, PAS_9, PAS domain 9e-05
smart0008643 smart00086, PAC, Motif C-terminal to PAS motifs (l 2e-04
PRK13558 665 PRK13558, PRK13558, bacterio-opsin activator; Prov 4e-04
PRK13558 665 PRK13558, PRK13558, bacterio-opsin activator; Prov 7e-04
pfam13426101 pfam13426, PAS_9, PAS domain 8e-04
>gnl|CDD|197509 smart00086, PAC, Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
 Score = 38.3 bits (90), Expect = 2e-05
 Identities = 11/31 (35%), Positives = 17/31 (54%)

Query: 64 GTPFWCLLDIVPIKNEKREVVLYLASHKDVT 94
          G+  W L+   PI++E  EV   L   +D+T
Sbjct: 11 GSYIWVLVSASPIRDEDGEVEGILGVVRDIT 41


PAC motif occurs C-terminal to a subset of all known PAS motifs. It is proposed to contribute to the PAS domain fold. Length = 43

>gnl|CDD|222120 pfam13426, PAS_9, PAS domain Back     alignment and domain information
>gnl|CDD|197509 smart00086, PAC, Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>gnl|CDD|237426 PRK13558, PRK13558, bacterio-opsin activator; Provisional Back     alignment and domain information
>gnl|CDD|237426 PRK13558, PRK13558, bacterio-opsin activator; Provisional Back     alignment and domain information
>gnl|CDD|222120 pfam13426, PAS_9, PAS domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 115
PRK13560 807 hypothetical protein; Provisional 99.49
PRK09776 1092 putative diguanylate cyclase; Provisional 99.46
PRK09776 1092 putative diguanylate cyclase; Provisional 99.27
PRK13560 807 hypothetical protein; Provisional 99.19
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 98.96
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 98.86
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 98.56
PF13426104 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_ 98.45
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 98.34
PF08448110 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold 98.19
PRK11359 799 cyclic-di-GMP phosphodiesterase; Provisional 98.16
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 98.13
PRK13559 361 hypothetical protein; Provisional 98.03
PRK13558 665 bacterio-opsin activator; Provisional 98.02
PRK10060 663 RNase II stability modulator; Provisional 98.02
PRK13559 361 hypothetical protein; Provisional 97.97
KOG0501|consensus 971 97.91
smart0008643 PAC Motif C-terminal to PAS motifs (likely to cont 97.87
PRK13557 540 histidine kinase; Provisional 97.83
KOG0501|consensus 971 97.81
PRK13558 665 bacterio-opsin activator; Provisional 97.76
smart0008643 PAC Motif C-terminal to PAS motifs (likely to cont 97.76
TIGR02938 494 nifL_nitrog nitrogen fixation negative regulator N 97.69
PRK13557 540 histidine kinase; Provisional 97.58
PRK11091 779 aerobic respiration control sensor protein ArcB; P 97.55
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 97.51
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 97.36
PRK11091 779 aerobic respiration control sensor protein ArcB; P 97.35
TIGR00229124 sensory_box PAS domain S-box. The PAS domain was p 97.28
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 97.2
PF00989113 PAS: PAS fold; InterPro: IPR013767 PAS domains are 97.13
PRK11360 607 sensory histidine kinase AtoS; Provisional 96.95
TIGR02040442 PpsR-CrtJ transcriptional regulator PpsR. This mod 96.87
PF0844791 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold 96.67
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 96.55
PRK11360 607 sensory histidine kinase AtoS; Provisional 95.96
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 95.7
PF13596106 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D. 95.47
cd00130103 PAS PAS domain; PAS motifs appear in archaea, euba 94.92
PF12860115 PAS_7: PAS fold 94.43
PF08348118 PAS_6: YheO-like PAS domain; InterPro: IPR013559 T 94.3
PRK10060 663 RNase II stability modulator; Provisional 92.85
PF12860115 PAS_7: PAS fold 92.57
PRK11073 348 glnL nitrogen regulation protein NR(II); Provision 92.48
TIGR02966 333 phoR_proteo phosphate regulon sensor kinase PhoR. 90.39
PRK11073 348 glnL nitrogen regulation protein NR(II); Provision 89.31
TIGR02966 333 phoR_proteo phosphate regulon sensor kinase PhoR. 88.34
PF0274381 Cache_1: Cache domain; InterPro: IPR004010 Cache i 87.84
COG5002 459 VicK Signal transduction histidine kinase [Signal 87.61
PRK11086 542 sensory histidine kinase DcuS; Provisional 87.05
PF08348118 PAS_6: YheO-like PAS domain; InterPro: IPR013559 T 86.74
COG5002 459 VicK Signal transduction histidine kinase [Signal 86.51
PRK11086 542 sensory histidine kinase DcuS; Provisional 86.08
PF14827116 Cache_3: Sensory domain of two-component sensor ki 85.65
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mech 83.74
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mech 83.31
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.49  E-value=1.5e-13  Score=115.49  Aligned_cols=98  Identities=16%  Similarity=0.211  Sum_probs=84.7

Q ss_pred             ecc-CCCceeEEEEEEEeeCCCCCEEEEEEEEEeccchhhhhhhc--------------------C--------------
Q psy8547           8 NYR-QRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMAD--------------------N--------------   52 (115)
Q Consensus         8 ~Yr-dG~~fw~~~~i~Pi~de~G~~~~fi~~~~DIT~~k~~e~~~--------------------~--------------   52 (115)
                      ..+ ||+.+|+.+...|++|++|++++++++..|||++|++|+++                    .              
T Consensus       428 ~~~~~g~~~~~~~~~~p~~d~~g~~~~~~~~~~DITerk~~E~~L~~~~~~~e~~~~~i~~~~~~~~~~~~~~~~~~~~~  507 (807)
T PRK13560        428 IEREDDGPADCSAYAEPLHDADGNIIGAIALLVDITERKQVEEQLLLANLIVENSPLVLFRWKAEEGWPVELVSKNITQF  507 (807)
T ss_pred             EEcCCCCeEEEEEEEeeeECCCCCEEEEEEEeehhhhHHHHHHHHHHHHHHHhcCCceEEEEecCCCceEEEecchhhhc
Confidence            335 99999999999999999999999999999999999988732                    0              


Q ss_pred             ---------CC-------------------------------CceeceecCCceeEEEEEeEEeeCCCCCEEEEEEEeee
Q psy8547          53 ---------GE-------------------------------GDYEDMQELGTPFWCLLDIVPIKNEKREVVLYLASHKD   92 (115)
Q Consensus        53 ---------~~-------------------------------e~~~~yrKdGs~f~~~~~i~pirde~G~v~~~i~~~~D   92 (115)
                               +.                               ..++..+|||+.+|......|++|++|++.+++++..|
T Consensus       508 G~~~~e~~~~~~~~~~~~~p~d~~~~~~~~~~~~~~g~~~~~~e~r~~~~dG~~~w~~~~~~~~~d~~G~~~~~~g~~~D  587 (807)
T PRK13560        508 GYEPDEFISGKRMFAAIIHPADLEQVAAEVAEFAAQGVDRFEQEYRILGKGGAVCWIDDQSAAERDEEGQISHFEGIVID  587 (807)
T ss_pred             CCCHHHhhcccchHhhhcChhhHHHHHHHHHHHHhcCCccceeEEEEEcCCCCEEEEEecceeeeCCCCCEEEEEEEEec
Confidence                     00                               01123579999999999999999999999999999999


Q ss_pred             cccchhhchhhcc
Q psy8547          93 VTNTKMAQMADNG  105 (115)
Q Consensus        93 IT~~k~~E~~~~~  105 (115)
                      ||++|++|++++.
T Consensus       588 ITerK~aE~~L~~  600 (807)
T PRK13560        588 ISERKHAEEKIKA  600 (807)
T ss_pred             hHHHHHHHHHHHH
Confidence            9999999998764



>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK09776 putative diguanylate cyclase; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>PF13426 PAS_9: PAS domain; PDB: 3ULF_B 3UE6_E 2Z6D_B 2Z6C_B 3P7N_B 1LL8_A 3MJQ_A 3BWL_A 4EET_B 4EEP_A Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PF08448 PAS_4: PAS fold; InterPro: IPR013656 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PRK11359 cyclic-di-GMP phosphodiesterase; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PF00989 PAS: PAS fold; InterPro: IPR013767 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain [] Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR Back     alignment and domain information
>PF08447 PAS_3: PAS fold; InterPro: IPR013655 The PAS fold corresponds to the structural domain that has previously been defined as PAS and PAC motifs [] Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PF13596 PAS_10: PAS domain; PDB: 3CAX_A 2QKP_D Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PF12860 PAS_7: PAS fold Back     alignment and domain information
>PF08348 PAS_6: YheO-like PAS domain; InterPro: IPR013559 This domain is found in various hypothetical bacterial proteins that are similar to the Escherichia coli protein YheO (P64624 from SWISSPROT) Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PF12860 PAS_7: PAS fold Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR Back     alignment and domain information
>PF02743 Cache_1: Cache domain; InterPro: IPR004010 Cache is an extracellular domain that is predicted to have a role in small-molecule recognition in a wide range of proteins, including the animal dihydropyridine-sensitive voltage-gated Ca2+ channel; alpha-2delta subunit, and various bacterial chemotaxis receptors Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PF08348 PAS_6: YheO-like PAS domain; InterPro: IPR013559 This domain is found in various hypothetical bacterial proteins that are similar to the Escherichia coli protein YheO (P64624 from SWISSPROT) Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PF14827 Cache_3: Sensory domain of two-component sensor kinase; PDB: 1OJG_A 3BY8_A 1P0Z_I 2V9A_A 2J80_B Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query115
1byw_A110 Protein (human ERG potassium channel); PAS domain, 3e-12
1byw_A110 Protein (human ERG potassium channel); PAS domain, 9e-12
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 4e-12
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 9e-12
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 1e-11
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 3e-11
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 4e-11
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 6e-11
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 5e-11
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 1e-10
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 1e-10
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 3e-10
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 3e-10
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 4e-10
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 5e-09
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 1e-08
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 5e-07
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 6e-07
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 6e-07
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 7e-07
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 1e-06
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 2e-06
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 4e-06
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 5e-06
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 Back     alignment and structure
 Score = 57.2 bits (139), Expect = 3e-12
 Identities = 13/36 (36%), Positives = 24/36 (66%), Gaps = 1/36 (2%)

Query: 8   NYRQ-RTPFWCLLDIVPIKNEKREVVLYLASHKDVT 42
            YR+  + F CL+D+VP+KNE   V++++ + + V 
Sbjct: 73  FYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVM 108


>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Length = 110 Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Length = 138 Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Length = 130 Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Length = 146 Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Length = 109 Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Length = 115 Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Length = 166 Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Length = 258 Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Length = 149 Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Length = 128 Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Length = 162 Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Length = 132 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
3ewk_A227 Sensor protein; PAS domain, alpha/beta fold, kinas 99.67
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 99.07
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 99.02
1n9l_A109 PHOT-LOV1, putative blue light receptor; phototrop 98.95
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 98.88
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 98.87
3mr0_A142 Sensory box histidine kinase/response regulator; P 98.85
3ewk_A 227 Sensor protein; PAS domain, alpha/beta fold, kinas 98.8
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 98.77
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 98.77
2gj3_A120 Nitrogen fixation regulatory protein; PAS domain, 98.76
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 98.75
3h9w_A115 Diguanylate cyclase with PAS/PAC sensor; alpha-bet 98.74
4hia_A176 LOV protein; PAS, HTH, signaling protein; HET: FMN 98.74
2pr5_A132 Blue-light photoreceptor; light-oxygen-voltage, LO 98.71
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 98.7
3t50_A128 Blue-light-activated histidine kinase; PAS superfa 98.7
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 98.67
3ue6_A166 Aureochrome1; PAS/LOV domain, FMN-binding blue-lig 98.64
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 98.64
3mr0_A142 Sensory box histidine kinase/response regulator; P 98.55
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 98.54
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 98.54
3f1p_A117 Endothelial PAS domain-containing protein 1; PAS d 98.53
3nja_A125 Probable ggdef family protein; structural genomics 98.51
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 98.5
3nja_A125 Probable ggdef family protein; structural genomics 98.5
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 98.5
4eet_B115 Phototropin-2; LOV, blue light photoreceptor, sign 98.47
4eho_A635 Bacteriophytochrome, PAS/PAC sensor; photoreceptor 98.47
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 98.43
2z6d_A130 Phototropin-2; PAS-fold, LOV-fold, alternative spl 98.43
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.43
3f1p_B121 ARYL hydrocarbon receptor nuclear translocator; PA 98.41
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 98.41
2vv6_A119 FIXL, sensor protein FIXL; signaling protein, tran 98.39
3p7n_A258 Sensor histidine kinase; LOV domain, light-activat 98.38
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 98.38
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 98.37
3sw1_A162 Sensory box protein; light-oxygen-voltage, LOV, PA 98.37
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 98.35
3mqq_A120 Transcriptional regulator, LUXR family; PAS domain 98.34
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 98.33
3k3c_A158 Protein RV1364C/MT1410; sensor, PAS, signal transd 98.33
1byw_A110 Protein (human ERG potassium channel); PAS domain, 98.32
2v0u_A146 NPH1-1, LOV2; kinase, transferase, ATP-binding, se 98.29
3lyx_A124 Sensory BOX/ggdef domain protein; structural genom 98.28
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 98.27
1byw_A110 Protein (human ERG potassium channel); PAS domain, 98.23
3kx0_X185 Uncharacterized protein RV1364C/MT1410; PAS domain 98.12
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 98.1
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 98.08
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 98.07
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 98.06
3icy_A118 Sensor protein; sensory box histidine kinase/respo 98.04
3mjq_A126 Uncharacterized protein; NESG, structural genomics 98.03
3mxq_A152 Sensor protein; PSI2, MCSG, structural genomics, p 98.02
3icy_A118 Sensor protein; sensory box histidine kinase/respo 98.01
3eeh_A125 Putative light and redox sensing histidine kinase; 97.97
2l0w_A138 Potassium voltage-gated channel, subfamily H (EAG 97.97
3luq_A114 Sensor protein; PAS, histidine, kinase, PSI, MCSG, 97.96
3eeh_A125 Putative light and redox sensing histidine kinase; 97.89
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 97.87
3vol_A233 Aerotaxis transducer AER2; heme, oxygen sensor pro 97.84
3vol_A233 Aerotaxis transducer AER2; heme, oxygen sensor pro 97.82
4f3l_A361 Mclock, circadian locomoter output cycles protein 97.8
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 97.75
2kdk_A121 ARYL hydrocarbon receptor nuclear translocator-LI 97.67
3d72_A149 Vivid PAS protein VVD; circadian, photoreceptor, b 97.66
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 97.65
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 97.64
1d06_A130 Nitrogen fixation regulatory protein FIXL; oxygen 97.62
3mjq_A126 Uncharacterized protein; NESG, structural genomics 97.57
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 97.55
4f3l_A361 Mclock, circadian locomoter output cycles protein 97.49
1v9y_A167 Heme PAS sensor protein; signaling protein; HET: H 97.47
4f3l_B387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 97.31
2r78_A117 Sensor protein; sensory box sensor histidine kinas 97.25
4hi4_A121 Aerotaxis transducer AER2; PAS domain, diatomic GA 97.17
3rty_A339 Period circadian protein; PAS domain, signalling, 97.09
2qkp_A151 Uncharacterized protein; structural genomics, unkn 96.89
3cax_A369 Uncharacterized protein PF0695; structural genomic 96.88
3olo_A118 Two-component sensor histidine kinase; structural 96.87
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 96.8
3olo_A118 Two-component sensor histidine kinase; structural 96.78
3cax_A369 Uncharacterized protein PF0695; structural genomic 96.68
2qkp_A151 Uncharacterized protein; structural genomics, unkn 96.66
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 96.64
3bwl_A126 Sensor protein; structural genomics, APC87707.1, P 96.63
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 96.49
3b33_A115 Sensor protein; structural genomics, PAS domain, n 96.46
1ll8_A114 PAS kinase; PAS domain, ligand binding, ligand scr 96.42
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 96.19
3mfx_A129 Sensory BOX/ggdef family protein; alpha-beta prote 96.12
3b33_A115 Sensor protein; structural genomics, PAS domain, n 96.06
3a0r_A 349 Sensor protein; four helix bundle, PAS fold, kinas 95.88
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 95.66
3fc7_A125 HTR-like protein, sensor protein; APC87712.1, HTR- 95.64
3a0r_A 349 Sensor protein; four helix bundle, PAS fold, kinas 95.32
3a0s_A96 Sensor protein; PAS-fold, kinase, phosphoprotein, 94.55
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 93.69
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 93.55
2w0n_A118 Sensor protein DCUS; signal transduction, two-comp 92.69
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 91.25
2ykf_A305 Pdtas, probable sensor histidine kinase pdtas; tra 90.09
2vlg_A111 Sporulation kinase A; histidine kinase, two-compon 90.43
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 90.37
4dj3_A317 Period circadian protein homolog 3; PAS domain, ci 89.21
3rty_A339 Period circadian protein; PAS domain, signalling, 89.06
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 88.95
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 88.08
2jhe_A190 Transcription regulator TYRR; aromatic hydrocarbon 87.4
1p0z_A131 Sensor kinase CITA; transferase; HET: FLC MO7; 1.6 86.54
3fg8_A118 Uncharacterized protein RHA05790; PAS domain, stru 85.29
4dj2_A320 Period circadian protein homolog 1; PAS domains, c 82.15
3by8_A142 Sensor protein DCUS; histidine kinase sensor domai 81.87
3gdi_A309 Period circadian protein homolog 2; tandem PAS dom 81.07
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
Probab=99.67  E-value=8e-16  Score=111.17  Aligned_cols=88  Identities=25%  Similarity=0.464  Sum_probs=74.3

Q ss_pred             ceeecc-CCCceeEEEEEEEeeCCCCCEEEEEEEEEeccchhhhhhhc--------------------------C-----
Q psy8547           5 PDTNYR-QRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNTKMAQMAD--------------------------N-----   52 (115)
Q Consensus         5 ~~~~Yr-dG~~fw~~~~i~Pi~de~G~~~~fi~~~~DIT~~k~~e~~~--------------------------~-----   52 (115)
                      +..+.+ ||+.+|+.++++|++|++|++.+++++.+|||++|++++.+                          |     
T Consensus        63 e~~~~~~dG~~~~~~~~~~p~~d~~g~~~~~~~~~~DIT~~k~~e~~l~~~~~~~~~~~~~i~~~d~~g~i~~~N~~~~~  142 (227)
T 3ewk_A           63 EFCNRRKDGTRYWVDSTIVPLMDNAGKPRQYISIRRDITAQKEAEAQLARLKQAMDANSEMILLTDRAGRIIYANPALCR  142 (227)
T ss_dssp             EEEEECSSSCEEEEEEEEEEEECSSSCEEEEEEEEEECTTTTHHHHHHHHHHHHHHTCCSEEEEECTTSCEEEECHHHHH
T ss_pred             EEEEEcCCCCEEeeeeEEEEEEcCCCCEEEEEEEEEehhhHHHHHHHHHHHHHHHhcCcCeEEEEcCCCcEEEEchHHHH
Confidence            344556 99999999999999999999999999999999999988732                          0     


Q ss_pred             ----------C--------C---------------------CceeceecCCc------eeEEEEEeEEeeCCCCCEEEEE
Q psy8547          53 ----------G--------E---------------------GDYEDMQELGT------PFWCLLDIVPIKNEKREVVLYL   87 (115)
Q Consensus        53 ----------~--------~---------------------e~~~~yrKdGs------~f~~~~~i~pirde~G~v~~~i   87 (115)
                                |        .                     .....++|||+      .||++++++|++|++|.+++|+
T Consensus       143 ~~G~~~~e~~g~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~k~G~~~~dg~~~~~~~~~~pi~d~~g~~~~~v  222 (227)
T 3ewk_A          143 FSGMAEGELLGQSPSILDSPLADQETLAAMQEALQAGQPWSGRLLNRRRTGPAPHDAEDYWAEISTTPIHTDGNGLVGYV  222 (227)
T ss_dssp             HHTCCTHHHHSSCGGGGBCTTSCHHHHHHHHHHHHHTCCEECCEEEEEECCSSSSCEEEEEEEEEEEEEECSSSCEEEEE
T ss_pred             HhCCCHHHHcCCChhhccCCCCCHHHHHHHHHHHHcCCceeEEEEEECCCCCcCcccceEEEEEEEEEEECCCCCEEEEE
Confidence                      0        0                     01234788887      8999999999999999999999


Q ss_pred             EEeee
Q psy8547          88 ASHKD   92 (115)
Q Consensus        88 ~~~~D   92 (115)
                      +++.|
T Consensus       223 ~i~~D  227 (227)
T 3ewk_A          223 QIQHD  227 (227)
T ss_dssp             EEEEC
T ss_pred             EEecC
Confidence            99987



>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>1n9l_A PHOT-LOV1, putative blue light receptor; phototropin, flavin, electron transport; HET: FMN; 1.90A {Chlamydomonas reinhardtii} SCOP: d.110.3.6 PDB: 1n9n_A* 1n9o_A* Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>3ewk_A Sensor protein; PAS domain, alpha/beta fold, kinase, phosphoprotein, transfe flavoprotein; HET: FAD; 2.34A {Methylococcus capsulatus} Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>2gj3_A Nitrogen fixation regulatory protein; PAS domain, FAD, redox sensor, atomic resolution, transferase; HET: FAD; 1.04A {Azotobacter vinelandii} Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>3h9w_A Diguanylate cyclase with PAS/PAC sensor; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.90A {Marinobacter aquaeolei} Back     alignment and structure
>4hia_A LOV protein; PAS, HTH, signaling protein; HET: FMN; 1.95A {Rhodobacter sphaeroides} PDB: 4hnb_A* 4hj4_A* 4hj6_A* 4hj3_A* Back     alignment and structure
>2pr5_A Blue-light photoreceptor; light-oxygen-voltage, LOV, PER-ARNT-SIM, PAS, flavoprotein, protein; HET: FMN; 1.45A {Bacillus subtilis} PDB: 2pr6_A* Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3t50_A Blue-light-activated histidine kinase; PAS superfamily, blue-light photoreceptor, FMN binding, TRAN; HET: FMN; 1.64A {Brucella melitensis} Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>3ue6_A Aureochrome1; PAS/LOV domain, FMN-binding blue-light photoreceptor, signal protein; HET: FMN; 2.75A {Vaucheria frigida} PDB: 3ulf_A* Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>3mr0_A Sensory box histidine kinase/response regulator; PAS fold, structural genomics, PSI-2; HET: PG5; 1.49A {Burkholderia thailandensis} Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>3f1p_A Endothelial PAS domain-containing protein 1; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.7 PDB: 3f1o_A* 3f1n_A 3h7w_A* 3h82_A* 1p97_A 2a24_A 4h6j_A Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>3nja_A Probable ggdef family protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.37A {Chromobacterium violaceum} Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>4eet_B Phototropin-2; LOV, blue light photoreceptor, signaling protein, flavoprote; HET: FMN; 1.20A {Arabidopsis thaliana} PDB: 4ees_A* 4eer_A* 4eep_A* 4eeu_A* 1jnu_A* 1g28_A* Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>2z6d_A Phototropin-2; PAS-fold, LOV-fold, alternative splicing, ATP-binding, chromophore, flavoprotein, FMN, kinase, membrane, nucleotide-binding; HET: FMN; 2.00A {Arabidopsis thaliana} PDB: 2z6c_A* Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3f1p_B ARYL hydrocarbon receptor nuclear translocator; PAS domain, heterodimer, internal cavity, activator, angiogenesis, congenital erythrocytosis; 1.17A {Homo sapiens} SCOP: d.110.3.0 PDB: 3f1o_B* 3f1n_B 3h7w_B* 3h82_B* 1x0o_A 2hv1_A 4h6j_B 2b02_A* 2k7s_A 2a24_B Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>2vv6_A FIXL, sensor protein FIXL; signaling protein, transferase, phosphoprotein, nitrogen FIX PER-ARNT-SIM, metal-binding, PAS, iron, heme; HET: HEM; 1.5A {Bradyrhizobium japonicum} PDB: 1xj6_A* 1xj4_A* 2vv7_A* 2vv8_A* 1lsw_A* 1dp8_A* 1dp9_A* 1drm_A* 1lsv_A* 1dp6_A* 1lsx_A* 1lt0_A* 1y28_A* 2cmn_A* 1xj3_A* 1xj2_A* 2owh_A* 2owj_A* Back     alignment and structure
>3p7n_A Sensor histidine kinase; LOV domain, light-activated transcription factor, DNA bindin; HET: FMN; 2.10A {Erythrobacter litoralis} Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>3sw1_A Sensory box protein; light-oxygen-voltage, LOV, PAS, signaling protein; HET: FMN; 2.63A {Pseudomonas putida} Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>3mqq_A Transcriptional regulator, LUXR family; PAS domain, PSI, MCSG, structural genomics, center for structural genomics; 1.65A {Burkholderia thailandensis} PDB: 3mqo_A Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3k3c_A Protein RV1364C/MT1410; sensor, PAS, signal transduction, fatty-acid binding, sigma regulator, signaling protein; HET: PLM; 1.62A {Mycobacterium tuberculosis} PDB: 3k3d_A Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>2v0u_A NPH1-1, LOV2; kinase, transferase, ATP-binding, serine/threonine-protein kinase, light-induced signal trans phototropin1, nucleotide-binding; HET: FMN; 1.40A {Avena sativa} PDB: 2v0w_A* 2v1b_A* 2v1a_A* 1jnu_A* 1g28_A* Back     alignment and structure
>3lyx_A Sensory BOX/ggdef domain protein; structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 2.00A {Colwellia psychrerythraea} Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1byw_A Protein (human ERG potassium channel); PAS domain, potassium channel domain, membrane protein; 2.60A {Homo sapiens} SCOP: d.110.3.6 Back     alignment and structure
>3kx0_X Uncharacterized protein RV1364C/MT1410; PAS domain, sensory domain, mycobacteium tuberculos molecule binding domain; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3mxq_A Sensor protein; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.78A {Vibrio cholerae o1 biovar el tor} Back     alignment and structure
>3icy_A Sensor protein; sensory box histidine kinase/response regulator domain, kinase, chlorobium tepidum TLS, PSI-2; 2.68A {Chlorobaculum tepidum} Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>2l0w_A Potassium voltage-gated channel, subfamily H (EAG member 2, isoform CRA_B; HERG, PAS domain, voltage-gated potassium channel, membrane; NMR {Homo sapiens} PDB: 2l1m_A 2l4r_A Back     alignment and structure
>3luq_A Sensor protein; PAS, histidine, kinase, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: PGE; 2.49A {Geobacter sulfurreducens} Back     alignment and structure
>3eeh_A Putative light and redox sensing histidine kinase; structural genomic MCSG, protein structure initiative, midwest center for STRU genomics; HET: PG5; 1.95A {Haloarcula marismortui} Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>3vol_A Aerotaxis transducer AER2; heme, oxygen sensor protein, PAS, HAMP, cyanoMet, CN-bound, protein; HET: HEM; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>2kdk_A ARYL hydrocarbon receptor nuclear translocator-LI 2; circadian clock, PAS domain, transcription, activator, biolo rhythms, DNA-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3d72_A Vivid PAS protein VVD; circadian, photoreceptor, blue-light, LOV, signaling protein; HET: FAD; 1.65A {Neurospora crassa} PDB: 3is2_A* 2pd8_A* 3hjk_A* 2pdr_A* 2pd7_A* 2pdt_A* 3hji_A* 3rh8_B* Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1d06_A Nitrogen fixation regulatory protein FIXL; oxygen sensor, histidine kinase, PAS, high-resolution, two-C system, signaling protein; HET: HEM; 1.40A {Sinorhizobium meliloti} SCOP: d.110.3.2 PDB: 1ew0_A* Back     alignment and structure
>3mjq_A Uncharacterized protein; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium; 2.60A {Desulfitobacterium hafniense} Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>1v9y_A Heme PAS sensor protein; signaling protein; HET: HEM; 1.32A {Escherichia coli} SCOP: d.110.3.2 PDB: 1v9z_A* 1vb6_A* 1s67_L* 1s66_L* Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>2r78_A Sensor protein; sensory box sensor histidine kinase/response regulator, structural genomics, PSI, MCSG; 1.60A {Geobacter sulfurreducens pca} Back     alignment and structure
>4hi4_A Aerotaxis transducer AER2; PAS domain, diatomic GAS sensor, signaling protein; HET: HEM GOL; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3olo_A Two-component sensor histidine kinase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG, TRA; 2.09A {Nostoc SP} Back     alignment and structure
>3cax_A Uncharacterized protein PF0695; structural genomics, unknown function, PSI-2, protein struct initiative; 2.43A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>2qkp_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 1.75A {Streptococcus mutans} Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>3bwl_A Sensor protein; structural genomics, APC87707.1, PAS domain, HTR-like protei protein structure initiative; HET: MSE I3A; 1.73A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1ll8_A PAS kinase; PAS domain, ligand binding, ligand screening, kinase regulation, transferase; NMR {Homo sapiens} SCOP: d.110.3.5 Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>3mfx_A Sensory BOX/ggdef family protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.40A {Shewanella oneidensis} Back     alignment and structure
>3b33_A Sensor protein; structural genomics, PAS domain, nitrogen regulation protein APC91440.4, PSI-2; HET: MSE; 1.83A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>3fc7_A HTR-like protein, sensor protein; APC87712.1, HTR-like protein,haloarcula marismortui ATCC 430 structural genomics, PSI-2; 2.65A {Haloarcula marismortui} Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transfe two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>3a0s_A Sensor protein; PAS-fold, kinase, phosphoprotein, transferase, two-component regulatory system; HET: PG4 PGE; 1.47A {Thermotoga maritima} PDB: 3a0v_A* Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>2w0n_A Sensor protein DCUS; signal transduction, two-component regulatory system, PAS, kinase, membrane, transferase, solid state cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>2ykf_A Pdtas, probable sensor histidine kinase pdtas; transferase, two-component system, GAF domain, PAS domain; 2.00A {Mycobacterium tuberculosis} PDB: 2ykh_A Back     alignment and structure
>2vlg_A Sporulation kinase A; histidine kinase, two-component regulatory system, two-component signal transduction, transferase, phosphorylation, SCOD; 1.7A {Bacillus subtilis} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>4dj3_A Period circadian protein homolog 3; PAS domain, circadian rhythm, protein binding; 2.50A {Mus musculus} Back     alignment and structure
>3rty_A Period circadian protein; PAS domain, signalling, timeless, circadian clock protein; 2.85A {Drosophila melanogaster} PDB: 1wa9_A 3gec_A Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure
>2jhe_A Transcription regulator TYRR; aromatic hydrocarbons catabolism, TYRR protei nucleotide-binding, transcription regulation, activator; HET: PG4; 2.30A {Escherichia coli} Back     alignment and structure
>1p0z_A Sensor kinase CITA; transferase; HET: FLC MO7; 1.60A {Klebsiella pneumoniae} SCOP: d.110.6.1 PDB: 2v9a_A 2j80_A* Back     alignment and structure
>3fg8_A Uncharacterized protein RHA05790; PAS domain, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; HET: 3PB; 1.80A {Rhodococcus SP} Back     alignment and structure
>4dj2_A Period circadian protein homolog 1; PAS domains, circadian clock protein, protein binding; 2.75A {Mus musculus} Back     alignment and structure
>3by8_A Sensor protein DCUS; histidine kinase sensor domain, inner membrane, membrane, phosphoprotein, transferase, transmembrane; 1.45A {Escherichia coli} SCOP: d.110.6.1 PDB: 1ojg_A Back     alignment and structure
>3gdi_A Period circadian protein homolog 2; tandem PAS domains, biological rhythms, cytoplasm, nucleus, phosphoprotein, transcription; 2.40A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query115
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 99.15
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 99.06
d1bywa_110 Erg potassium channel, N-terminal domain {Human (H 99.05
d1n9la_109 Putative blue light receptor, phot-lov1 domain {Gr 98.99
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 98.72
d1jnua_104 Photoreceptor phy3 flavin-binding domain, lov2 {Ma 98.63
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 98.59
d1p97a_114 Hypoxia-inducible factor Hif2a, C-terminal domain 98.44
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 98.15
d1xj3a1106 Histidine kinase FixL heme domain {Bradyrhizobium 98.11
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 97.66
d1ew0a_130 Histidine kinase FixL heme domain {Rhizobium melil 97.66
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 97.59
d1v9ya_113 Direct oxygen sensor protein, DOS {Escherichia col 97.5
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 96.41
d1ll8a_114 N-terminal PAS domain of Pas kinase {Human (Homo s 96.19
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 94.41
d1oj5a_109 PAS domain of steroid receptor coactivator 1A, NCo 92.22
d1p0za_131 Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 82.53
d3by8a1133 Fumarate sensor DcuS {Escherichia coli [TaxId: 562 80.38
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Profilin-like
superfamily: PYP-like sensor domain (PAS domain)
family: Flavin-binding PAS domain
domain: Erg potassium channel, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.15  E-value=2.7e-11  Score=77.41  Aligned_cols=42  Identities=31%  Similarity=0.608  Sum_probs=38.4

Q ss_pred             ccceeecc-CCCceeEEEEEEEeeCCCCCEEEEEEEEEeccch
Q psy8547           3 THPDTNYR-QRTPFWCLLDIVPIKNEKREVVLYLASHKDVTNT   44 (115)
Q Consensus         3 ~~~~~~Yr-dG~~fw~~~~i~Pi~de~G~~~~fi~~~~DIT~~   44 (115)
                      ..+..++| +|+.||+.++++||+|++|++++|+++++|||+|
T Consensus        68 ~~e~~~~~~~g~~~w~~~~~~pi~d~~G~v~~~i~~~~DITer  110 (110)
T d1bywa_          68 KVEIAFYRKDGSCFLCLVDVVPVKNEDGAVIMFILNFEVVMEK  110 (110)
T ss_dssp             EEEEEEECTTSCEEEEEEEEEEEECTTCCEEEEEEEEEEEEEC
T ss_pred             cceeeeeecccceeeeeeeEEEEECCCCCEEEEEEEEEECCCC
Confidence            34566778 9999999999999999999999999999999986



>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1bywa_ d.110.3.6 (A:) Erg potassium channel, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n9la_ d.110.3.6 (A:) Putative blue light receptor, phot-lov1 domain {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1jnua_ d.110.3.6 (A:) Photoreceptor phy3 flavin-binding domain, lov2 {Maidenhair fern (Adiantum capillus-veneris) [TaxId: 13818]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p97a_ d.110.3.7 (A:) Hypoxia-inducible factor Hif2a, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1xj3a1 d.110.3.2 (A:154-259) Histidine kinase FixL heme domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1ew0a_ d.110.3.2 (A:) Histidine kinase FixL heme domain {Rhizobium meliloti [TaxId: 382]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v9ya_ d.110.3.2 (A:) Direct oxygen sensor protein, DOS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ll8a_ d.110.3.5 (A:) N-terminal PAS domain of Pas kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oj5a_ d.110.3.8 (A:) PAS domain of steroid receptor coactivator 1A, NCo-A1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p0za_ d.110.6.1 (A:) Sensor kinase CitA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d3by8a1 d.110.6.1 (A:46-178) Fumarate sensor DcuS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure