Diaphorina citri psyllid: psy8556


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------30
MRDVKDVLDRDTETDPQQRQLTADFRRIRTGKLLFRKTKVAILGPTASGKSSVALKISEYIPCEIISIDSALVYCDMDIGTNKPSIIEREITPHHLIDIIEPTKSYSVIQFCEDALFSIKNILKKKKLPLLVGGTMLYFKALRDGINKLPPANLKLRTKFNIDINKYGISFLYDKLKLLDPVTANQPSNRHILHKRISDRFKKMLDQDLLINEVKKIRKKWNLNLNLPSMKCIGYRQTWEYIDGLIDRNTLKEKSIIATRQLAKQQLTWLRNMNEKITIDCLEKNCVQKILNLIKDIF
cccHHHHHccccccccHHHHHHHHHcccccccccccccEEEEEccccccHHHHHHHHHHHccccEEEccHHHHHcccccccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHcccccEEEcccHHHHHHHHccccccccccHHHHHHHHHHHHHHcHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccEEEccccccHHHHHHHHHHHHc
**********************************FRKTKVAILGPTASGKSSVALKISEYIPCEIISIDSALVYCDMDIGTNKPSIIEREITPHHLIDIIEPTKSYSVIQFCEDALFSIKNILKKKKLPLLVGGTMLYFKALRDGINKLPPANLKLRTKFNIDINKYGISFLYDKLKLLDPVTANQPSNRHILHKRISDRFKKMLDQDLLINEVKKIRKKWNLNLNLPSMKCIGYRQTWEYIDGLIDRNTLKEKSIIATRQLAKQQLTWLRNMNEKITIDCLEKNCVQKILNLIKDIF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRDVKDVLDRDTETDPQQRQLTADFRRIRTGKLLFRKTKVAILGPTASGKSSVALKISEYIPCEIISIDSALVYCDMDIGTNKPSIIEREITPHHLIDIIEPTKSYSVIQFCEDALFSIKNILKKKKLPLLVGGTMLYFKALRDGINKLPPANLKLRTKFNIDINKYGISFLYDKLKLLDPVTANQPSNRHILHKRISDRFKKMLDQDLLINEVKKIRKKWNLNLNLPSMKCIGYRQTWEYIDGLIDRNTLKEKSIIATRQLAKQQLTWLRNMNEKITIDCLEKNCVQKILNLIKDIF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
tRNA dimethylallyltransferase Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).confidentQ5WTA1
tRNA dimethylallyltransferase Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).confidentB8CIX4
tRNA dimethylallyltransferase Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 in tRNAs that read codons beginning with uridine, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).confidentA2S552

Prediction of Gene Ontology Terms ?

No confident GO terms associated with the query are predicted

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.5.-.-Transferring alkyl or aryl groups, other than methyl groups.probable
2.5.1.-5,10-methenyltetrahydromethanopterin hydrogenase.probable
2.5.1.75Transferred entry: 2.5.1.75.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CRM, chain A
Confidence level:very confident
Coverage over the Query: 187-295
View the alignment between query and template
View the model in PyMOL
Template: 2PJZ, chain A
Confidence level:confident
Coverage over the Query: 11-166
View the alignment between query and template
View the model in PyMOL