Psyllid ID: psy8556
Local Sequence Feature Prediction
Prediction and (Method) | Result |
---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
GI | Alignment Graph | Length | Definition | Q cover | H cover | Identity | E-value |
Query | 298 | ||||||
237748582 | 312 | tRNA delta(2)-isopentenylpyrophosphate t | 0.869 | 0.830 | 0.480 | 2e-76 | |
409404612 | 318 | tRNA delta2-isopentenylpyrophosphate tra | 0.875 | 0.820 | 0.454 | 3e-74 | |
300310167 | 315 | tRNA delta2-isopentenylpyrophosphate tra | 0.862 | 0.815 | 0.453 | 6e-74 | |
399017674 | 319 | tRNA isopentenyltransferase MiaA [Herbas | 0.859 | 0.802 | 0.451 | 3e-73 | |
398836370 | 314 | tRNA isopentenyltransferase MiaA [Herbas | 0.812 | 0.770 | 0.452 | 4e-73 | |
395763877 | 315 | tRNA delta(2)-isopentenylpyrophosphate t | 0.872 | 0.825 | 0.465 | 4e-73 | |
237745901 | 313 | tRNA delta(2)-isopentenylpyrophosphate t | 0.865 | 0.824 | 0.442 | 6e-73 | |
340788754 | 353 | tRNA delta(2)-isopentenylpyrophosphate t | 0.855 | 0.722 | 0.466 | 3e-72 | |
152979929 | 314 | tRNA delta(2)-isopentenylpyrophosphate t | 0.859 | 0.815 | 0.451 | 5e-72 | |
329904232 | 320 | tRNA delta(2)-isopentenylpyrophosphate t | 0.862 | 0.803 | 0.460 | 6e-70 |
>gi|237748582|ref|ZP_04579062.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter formigenes OXCC13] gi|229379944|gb|EEO30035.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter formigenes OXCC13] | Back alignment and taxonomy information |
---|
Score = 291 bits (745), Expect = 2e-76, Method: Compositional matrix adjust. Identities = 146/304 (48%), Positives = 195/304 (64%), Gaps = 45/304 (14%) Query: 40 VAILGPTASGKSSVALKISEYIPCEIISIDSALVYCDMDIGTNKPSIIEREITPHHLIDI 99 +AI+GPTASGK++ AL I++ IP EIIS+DSALVY +MDIGT KPS ER PHHLIDI Sbjct: 9 IAIMGPTASGKTAAALDIAQNIPSEIISVDSALVYREMDIGTAKPSQEERASVPHHLIDI 68 Query: 100 IEPTKSYSVIQFCEDALFSIKNILKKKKLPLLVGGTMLYFKALRDGINKLPPANLKLRTK 159 I+P+++YSV QF ED L I I ++ KLPLLVGGTMLYFK L G++ LP AN ++R K Sbjct: 69 IDPSQTYSVAQFREDTLRLITEIRQRGKLPLLVGGTMLYFKGLTSGLDDLPGANPEIRAK 128 Query: 160 FNIDINKYGISFLYDKLKLLDPVTAN---------------------------------- 185 + + + G ++ KL LDPVTA+ Sbjct: 129 LDEEAAQIGWPGMHAKLSSLDPVTADRLKPNDAQRIQRALEIIELTGKPLSELHSGQQAR 188 Query: 186 -----------QPSNRHILHKRISDRFKKMLDQDLLINEVKKIRKKWNLNLNLPSMKCIG 234 +PS+R LH+RI+ RF +ML DLLI EV+K+R++ +L+ +PSM+C+G Sbjct: 189 SFPFDIIPIALEPSDRSKLHERIALRFDQMLKDDLLIEEVRKLRERGDLHPGMPSMRCVG 248 Query: 235 YRQTWEYIDGLIDRNTLKEKSIIATRQLAKQQLTWLRNMNEKITIDCLEKNCVQKILNLI 294 YRQTWEY+DG DR L+EK I ATRQLAK+QLTWLR+M E+I+IDCL N + I+ + Sbjct: 249 YRQTWEYLDGEFDRKALREKGIAATRQLAKRQLTWLRSMPERISIDCLSPNALSDIMTHV 308 Query: 295 KDIF 298 ++ Sbjct: 309 ENAL 312 |
Source: Oxalobacter formigenes OXCC13 Species: Oxalobacter formigenes Genus: Oxalobacter Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
>gi|409404612|ref|ZP_11253091.1| tRNA delta2-isopentenylpyrophosphate transferase [Herbaspirillum sp. GW103] gi|386436131|gb|EIJ48954.1| tRNA delta2-isopentenylpyrophosphate transferase [Herbaspirillum sp. GW103] | Back alignment and taxonomy information |
---|
>gi|300310167|ref|YP_003774259.1| tRNA delta2-isopentenylpyrophosphate transferase [Herbaspirillum seropedicae SmR1] gi|300072952|gb|ADJ62351.1| tRNA delta2-isopentenylpyrophosphate transferase protein [Herbaspirillum seropedicae SmR1] | Back alignment and taxonomy information |
---|
>gi|399017674|ref|ZP_10719863.1| tRNA isopentenyltransferase MiaA [Herbaspirillum sp. CF444] gi|398102441|gb|EJL92621.1| tRNA isopentenyltransferase MiaA [Herbaspirillum sp. CF444] | Back alignment and taxonomy information |
---|
>gi|398836370|ref|ZP_10593707.1| tRNA isopentenyltransferase MiaA [Herbaspirillum sp. YR522] gi|398212004|gb|EJM98615.1| tRNA isopentenyltransferase MiaA [Herbaspirillum sp. YR522] | Back alignment and taxonomy information |
---|
>gi|395763877|ref|ZP_10444546.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Janthinobacterium lividum PAMC 25724] | Back alignment and taxonomy information |
---|
>gi|237745901|ref|ZP_04576381.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter formigenes HOxBLS] gi|229377252|gb|EEO27343.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacter formigenes HOxBLS] | Back alignment and taxonomy information |
---|
>gi|340788754|ref|YP_004754219.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Collimonas fungivorans Ter331] gi|340554021|gb|AEK63396.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Collimonas fungivorans Ter331] | Back alignment and taxonomy information |
---|
>gi|152979929|ref|YP_001352151.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Janthinobacterium sp. Marseille] gi|166198913|sp|A6SV54.1|MIAA_JANMA RecName: Full=tRNA dimethylallyltransferase; AltName: Full=Dimethylallyl diphosphate:tRNA dimethylallyltransferase; Short=DMAPP:tRNA dimethylallyltransferase; Short=DMATase; AltName: Full=Isopentenyl-diphosphate:tRNA isopentenyltransferase; Short=IPP transferase; Short=IPPT; Short=IPTase gi|151280006|gb|ABR88416.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Janthinobacterium sp. Marseille] | Back alignment and taxonomy information |
---|
>gi|329904232|ref|ZP_08273711.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacteraceae bacterium IMCC9480] gi|327548095|gb|EGF32820.1| tRNA delta(2)-isopentenylpyrophosphate transferase [Oxalobacteraceae bacterium IMCC9480] | Back alignment and taxonomy information |
---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
ID | Alignment graph | Length | Definition | Q cover | H cover | Identity | E-value |
Query | 298 | ||||||
TIGR_CMR|SO_0602 | 308 | SO_0602 "tRNA delta(2)-isopent | 0.493 | 0.477 | 0.462 | 1.1e-54 | |
TIGR_CMR|CPS_0324 | 316 | CPS_0324 "tRNA delta(2)-isopen | 0.493 | 0.465 | 0.435 | 4.2e-51 | |
TIGR_CMR|CBU_1082 | 311 | CBU_1082 "tRNA delta(2)-isopen | 0.486 | 0.466 | 0.427 | 2.3e-50 | |
UNIPROTKB|Q9KV12 | 315 | miaA "tRNA dimethylallyltransf | 0.486 | 0.460 | 0.448 | 9.8e-50 | |
TIGR_CMR|VC_0346 | 315 | VC_0346 "tRNA delta(2)-isopent | 0.486 | 0.460 | 0.448 | 9.8e-50 | |
UNIPROTKB|P16384 | 316 | miaA "tRNA(i6A37) synthase" [E | 0.486 | 0.458 | 0.420 | 5.3e-47 | |
TIGR_CMR|GSU_2000 | 311 | GSU_2000 "tRNA delta(2)-isopen | 0.510 | 0.488 | 0.371 | 1.8e-29 | |
UNIPROTKB|Q97RW5 | 294 | miaA "tRNA dimethylallyltransf | 0.365 | 0.370 | 0.418 | 1.6e-28 | |
TIGR_CMR|BA_3843 | 314 | BA_3843 "tRNA delta(2)-isopent | 0.506 | 0.480 | 0.326 | 8.7e-23 | |
TIGR_CMR|CHY_1394 | 311 | CHY_1394 "tRNA delta(2)-isopen | 0.842 | 0.807 | 0.318 | 2.4e-21 |
TIGR_CMR|SO_0602 SO_0602 "tRNA delta(2)-isopentenylpyrophosphate transferase" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
---|
Score = 326 (119.8 bits), Expect = 1.1e-54, Sum P(2) = 1.1e-54 Identities = 68/147 (46%), Positives = 97/147 (65%) Query: 40 VAILGPTASGKSSVALKISEYIPCEIISIDSALVYCDMDIGTNKPSIIEREITPHHLIDI 99 V ++GPTASGK+++AL+++E CEIIS+DSAL+Y MDIG+ KPS E PH LIDI Sbjct: 10 VFLMGPTASGKTALALELAEKHNCEIISVDSALIYRGMDIGSAKPSAEELARGPHRLIDI 69 Query: 100 IEPTKSYSVIQFCEDALFSIKNIXXXXXXXXXVGGTMLYFKALRDGINKLPPANLKLRTK 159 +P++SYS F DAL I+ I VGGTM+YFKAL +G++ LP A+ +R Sbjct: 70 RDPSESYSAADFRADALSEIEQIISMGKTPLLVGGTMMYFKALLEGLSPLPSADEVIRAD 129 Query: 160 FNIDINKYGISFLYDKLKLLDPVTANQ 186 + + G L+D+L+ +DPV+A + Sbjct: 130 IQAEADANGWEALHDQLREIDPVSAER 156 |
|
TIGR_CMR|CPS_0324 CPS_0324 "tRNA delta(2)-isopentenylpyrophosphate transferase" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
---|
TIGR_CMR|CBU_1082 CBU_1082 "tRNA delta(2)-isopentenylpyrophosphate transferase" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
---|
UNIPROTKB|Q9KV12 miaA "tRNA dimethylallyltransferase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
---|
TIGR_CMR|VC_0346 VC_0346 "tRNA delta(2)-isopentenylpyrophosphate transferase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
---|
UNIPROTKB|P16384 miaA "tRNA(i6A37) synthase" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
---|
TIGR_CMR|GSU_2000 GSU_2000 "tRNA delta(2)-isopentenylpyrophosphate transferase" [Geobacter sulfurreducens PCA (taxid:243231)] | Back alignment and assigned GO terms |
---|
UNIPROTKB|Q97RW5 miaA "tRNA dimethylallyltransferase" [Streptococcus pneumoniae TIGR4 (taxid:170187)] | Back alignment and assigned GO terms |
---|
TIGR_CMR|BA_3843 BA_3843 "tRNA delta(2)-isopentenylpyrophosphate transferase" [Bacillus anthracis str. Ames (taxid:198094)] | Back alignment and assigned GO terms |
---|
TIGR_CMR|CHY_1394 CHY_1394 "tRNA delta(2)-isopentenylpyrophosphate transferase" [Carboxydothermus hydrogenoformans Z-2901 (taxid:246194)] | Back alignment and assigned GO terms |
---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
ID | Alignment Graph | Length | Definition | E-value |
Query | 298 | |||
PRK00091 | 307 | PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosp | 1e-104 | |
COG0324 | 308 | COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosph | 2e-86 | |
TIGR00174 | 287 | TIGR00174, miaA, tRNA dimethylallyltransferase | 2e-66 | |
pfam01715 | 253 | pfam01715, IPPT, IPP transferase | 5e-62 | |
PRK14729 | 300 | PRK14729, miaA, tRNA delta(2)-isopentenylpyrophosp | 7e-31 | |
PLN02840 | 421 | PLN02840, PLN02840, tRNA dimethylallyltransferase | 1e-27 | |
PLN02748 | 468 | PLN02748, PLN02748, tRNA dimethylallyltransferase | 6e-23 | |
PLN02165 | 334 | PLN02165, PLN02165, adenylate isopentenyltransfera | 9e-15 | |
PLN02840 | 421 | PLN02840, PLN02840, tRNA dimethylallyltransferase | 4e-04 | |
pfam13207 | 114 | pfam13207, AAA_17, AAA domain | 0.001 |
>gnl|CDD|234626 PRK00091, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
---|
Score = 305 bits (783), Expect = e-104 Identities = 112/298 (37%), Positives = 168/298 (56%), Gaps = 44/298 (14%) Query: 40 VAILGPTASGKSSVALKISEYIPCEIISIDSALVYCDMDIGTNKPSIIEREITPHHLIDI 99 + I+GPTASGK+++A+++++ + EIIS DS VY MDIGT KP+ ER PHHLIDI Sbjct: 7 IVIVGPTASGKTALAIELAKRLNGEIISADSMQVYRGMDIGTAKPTAEERAGVPHHLIDI 66 Query: 100 IEPTKSYSVIQFCEDALFSIKNILKKKKLPLLVGGTMLYFKALRDGINKLPPANLKLRTK 159 ++PT+SYSV F DAL +I +IL + KLP+LVGGT LY KAL +G++ LPPA+ +LR + Sbjct: 67 LDPTESYSVADFQRDALAAIADILARGKLPILVGGTGLYIKALLEGLSPLPPADPELRAE 126 Query: 160 FNIDINKYGISFLYDKLKLLDPVTANQ--PSN---------------------------- 189 + G L+ +L +DP A + P++ Sbjct: 127 LEALAAEEGWEALHAELAEIDPEAAARIHPNDPQRIIRALEVYELTGKPLSELQKRGKPP 186 Query: 190 ------------RHILHKRISDRFKKMLDQDLLINEVKKIRKKWNLNLNLPSMKCIGYRQ 237 R L++RI+ R +ML+Q L+ EV+ + + L +LP+M+ IGY++ Sbjct: 187 PYRVLIIGLDPDREELYERINQRVDQMLEQG-LLEEVRALLARGYLP-DLPAMRAIGYKE 244 Query: 238 TWEYIDGLIDRNTLKEKSIIATRQLAKQQLTWLRNMNEKITIDCLEKNCVQKILNLIK 295 Y+DG I EK ATRQ AK+QLTW R + +D + +++IL L++ Sbjct: 245 LLAYLDGEISLEEAIEKIKQATRQYAKRQLTWFRRQPDIHWLDLSPEEALEEILRLLE 302 |
Length = 307 |
>gnl|CDD|223401 COG0324, MiaA, tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
---|
>gnl|CDD|213512 TIGR00174, miaA, tRNA dimethylallyltransferase | Back alignment and domain information |
---|
>gnl|CDD|216659 pfam01715, IPPT, IPP transferase | Back alignment and domain information |
---|
>gnl|CDD|173191 PRK14729, miaA, tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
---|
>gnl|CDD|215451 PLN02840, PLN02840, tRNA dimethylallyltransferase | Back alignment and domain information |
---|
>gnl|CDD|215399 PLN02748, PLN02748, tRNA dimethylallyltransferase | Back alignment and domain information |
---|
>gnl|CDD|177823 PLN02165, PLN02165, adenylate isopentenyltransferase | Back alignment and domain information |
---|
>gnl|CDD|215451 PLN02840, PLN02840, tRNA dimethylallyltransferase | Back alignment and domain information |
---|
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain | Back alignment and domain information |
---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
ID | Alignment Graph | Length | Definition | Probability |
Query | 298 | |||
PRK14729 | 300 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 100.0 | |
COG0324 | 308 | MiaA tRNA delta(2)-isopentenylpyrophosphate transf | 100.0 | |
TIGR00174 | 287 | miaA tRNA isopentenyltransferase (miaA). Catalyzes | 100.0 | |
PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 100.0 | |
PLN02840 | 421 | tRNA dimethylallyltransferase | 100.0 | |
PLN02748 | 468 | tRNA dimethylallyltransferase | 100.0 | |
PF01715 | 253 | IPPT: IPP transferase; InterPro: IPR002627 tRNA is | 100.0 | |
PLN02165 | 334 | adenylate isopentenyltransferase | 100.0 | |
KOG1384|consensus | 348 | 100.0 | ||
PF01745 | 233 | IPT: Isopentenyl transferase; InterPro: IPR002648 | 99.91 | |
COG0572 | 218 | Udk Uridine kinase [Nucleotide transport and metab | 99.32 | |
COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 99.13 | |
COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 99.13 | |
PRK00300 | 205 | gmk guanylate kinase; Provisional | 99.08 | |
TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 99.07 | |
COG3842 | 352 | PotA ABC-type spermidine/putrescine transport syst | 99.04 | |
PTZ00301 | 210 | uridine kinase; Provisional | 99.03 | |
COG2884 | 223 | FtsE Predicted ATPase involved in cell division [C | 99.02 | |
COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 98.94 | |
COG1131 | 293 | CcmA ABC-type multidrug transport system, ATPase c | 98.93 | |
COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 98.9 | |
COG0410 | 237 | LivF ABC-type branched-chain amino acid transport | 98.9 | |
COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 98.89 | |
cd03292 | 214 | ABC_FtsE_transporter FtsE is a hydrophilic nucleot | 98.88 | |
cd03259 | 213 | ABC_Carb_Solutes_like ABC Carbohydrate and Solute | 98.87 | |
COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 98.87 | |
cd03256 | 241 | ABC_PhnC_transporter ABC-type phosphate/phosphonat | 98.84 | |
cd03215 | 182 | ABC_Carb_Monos_II This family represents domain II | 98.84 | |
COG1124 | 252 | DppF ABC-type dipeptide/oligopeptide/nickel transp | 98.84 | |
PRK15453 | 290 | phosphoribulokinase; Provisional | 98.83 | |
PRK11650 | 356 | ugpC glycerol-3-phosphate transporter ATP-binding | 98.83 | |
TIGR02315 | 243 | ABC_phnC phosphonate ABC transporter, ATP-binding | 98.83 | |
PRK05480 | 209 | uridine/cytidine kinase; Provisional | 98.82 | |
cd03229 | 178 | ABC_Class3 This class is comprised of all BPD (Bin | 98.82 | |
COG1121 | 254 | ZnuC ABC-type Mn/Zn transport systems, ATPase comp | 98.81 | |
TIGR00960 | 216 | 3a0501s02 Type II (General) Secretory Pathway (IIS | 98.8 | |
cd03255 | 218 | ABC_MJ0796_Lo1CDE_FtsE This family is comprised of | 98.8 | |
PRK10851 | 353 | sulfate/thiosulfate transporter subunit; Provision | 98.8 | |
TIGR02673 | 214 | FtsE cell division ATP-binding protein FtsE. This | 98.79 | |
COG4559 | 259 | ABC-type hemin transport system, ATPase component | 98.78 | |
cd03230 | 173 | ABC_DR_subfamily_A This family of ATP-binding prot | 98.77 | |
TIGR03265 | 353 | PhnT2 putative 2-aminoethylphosphonate ABC transpo | 98.77 | |
PRK14737 | 186 | gmk guanylate kinase; Provisional | 98.76 | |
cd03262 | 213 | ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- | 98.76 | |
cd03258 | 233 | ABC_MetN_methionine_transporter MetN (also known a | 98.76 | |
PRK11432 | 351 | fbpC ferric transporter ATP-binding subunit; Provi | 98.75 | |
PLN02348 | 395 | phosphoribulokinase | 98.75 | |
cd03225 | 211 | ABC_cobalt_CbiO_domain1 Domain I of the ABC compon | 98.75 | |
cd03261 | 235 | ABC_Org_Solvent_Resistant ABC (ATP-binding cassett | 98.74 | |
cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 98.74 | |
COG3840 | 231 | ThiQ ABC-type thiamine transport system, ATPase co | 98.74 | |
PRK13536 | 340 | nodulation factor exporter subunit NodI; Provision | 98.74 | |
cd03265 | 220 | ABC_DrrA DrrA is the ATP-binding protein component | 98.73 | |
PLN02318 | 656 | phosphoribulokinase/uridine kinase | 98.73 | |
TIGR02211 | 221 | LolD_lipo_ex lipoprotein releasing system, ATP-bin | 98.73 | |
TIGR01188 | 302 | drrA daunorubicin resistance ABC transporter ATP-b | 98.73 | |
cd03246 | 173 | ABCC_Protease_Secretion This family represents the | 98.72 | |
cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 98.72 | |
PRK04220 | 301 | 2-phosphoglycerate kinase; Provisional | 98.72 | |
COG4619 | 223 | ABC-type uncharacterized transport system, ATPase | 98.72 | |
cd03218 | 232 | ABC_YhbG The ABC transporters belonging to the Yhb | 98.71 | |
PRK11000 | 369 | maltose/maltodextrin transporter ATP-binding prote | 98.71 | |
cd03295 | 242 | ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin | 98.7 | |
PRK11629 | 233 | lolD lipoprotein transporter ATP-binding subunit; | 98.7 | |
cd03301 | 213 | ABC_MalK_N The N-terminal ATPase domain of the mal | 98.69 | |
TIGR00235 | 207 | udk uridine kinase. Model contains a number of lon | 98.68 | |
cd03293 | 220 | ABC_NrtD_SsuB_transporters NrtD and SsuB are the A | 98.68 | |
COG3638 | 258 | ABC-type phosphate/phosphonate transport system, A | 98.68 | |
TIGR02314 | 343 | ABC_MetN D-methionine ABC transporter, ATP-binding | 98.68 | |
PRK09452 | 375 | potA putrescine/spermidine ABC transporter ATPase | 98.68 | |
COG1125 | 309 | OpuBA ABC-type proline/glycine betaine transport s | 98.68 | |
COG0396 | 251 | sufC Cysteine desulfurase activator ATPase [Posttr | 98.68 | |
cd03219 | 236 | ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans | 98.67 | |
cd03266 | 218 | ABC_NatA_sodium_exporter NatA is the ATPase compon | 98.67 | |
TIGR03258 | 362 | PhnT 2-aminoethylphosphonate ABC transport system, | 98.67 | |
PRK13537 | 306 | nodulation ABC transporter NodI; Provisional | 98.66 | |
cd02029 | 277 | PRK_like Phosphoribulokinase-like (PRK-like) is a | 98.66 | |
cd03216 | 163 | ABC_Carb_Monos_I This family represents the domain | 98.66 | |
cd03268 | 208 | ABC_BcrA_bacitracin_resist The BcrA subfamily repr | 98.65 | |
TIGR01288 | 303 | nodI ATP-binding ABC transporter family nodulation | 98.65 | |
PRK11153 | 343 | metN DL-methionine transporter ATP-binding subunit | 98.65 | |
PRK13644 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.65 | |
cd03213 | 194 | ABCG_EPDR ABCG transporters are involved in eye pi | 98.65 | |
cd03269 | 210 | ABC_putative_ATPase This subfamily is involved in | 98.64 | |
COG1118 | 345 | CysA ABC-type sulfate/molybdate transport systems, | 98.64 | |
cd03298 | 211 | ABC_ThiQ_thiamine_transporter ABC-type thiamine tr | 98.64 | |
TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 98.64 | |
TIGR03411 | 242 | urea_trans_UrtD urea ABC transporter, ATP-binding | 98.64 | |
PRK09493 | 240 | glnQ glutamine ABC transporter ATP-binding protein | 98.64 | |
TIGR01186 | 363 | proV glycine betaine/L-proline transport ATP bindi | 98.63 | |
COG0411 | 250 | LivG ABC-type branched-chain amino acid transport | 98.63 | |
cd03233 | 202 | ABC_PDR_domain1 The pleiotropic drug resistance (P | 98.63 | |
PRK11607 | 377 | potG putrescine transporter ATP-binding subunit; P | 98.62 | |
cd03222 | 177 | ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi | 98.62 | |
PRK07429 | 327 | phosphoribulokinase; Provisional | 98.62 | |
cd03297 | 214 | ABC_ModC_molybdenum_transporter ModC is an ABC-typ | 98.61 | |
COG2274 | 709 | SunT ABC-type bacteriocin/lantibiotic exporters, c | 98.61 | |
TIGR01166 | 190 | cbiO cobalt transport protein ATP-binding subunit. | 98.6 | |
cd02028 | 179 | UMPK_like Uridine monophosphate kinase_like (UMPK_ | 98.6 | |
TIGR03864 | 236 | PQQ_ABC_ATP ABC transporter, ATP-binding subunit, | 98.59 | |
TIGR02142 | 354 | modC_ABC molybdenum ABC transporter, ATP-binding p | 98.59 | |
TIGR03522 | 301 | GldA_ABC_ATP gliding motility-associated ABC trans | 98.59 | |
cd03226 | 205 | ABC_cobalt_CbiO_domain2 Domain II of the ABC compo | 98.59 | |
PRK11144 | 352 | modC molybdate transporter ATP-binding protein; Pr | 98.59 | |
PF00485 | 194 | PRK: Phosphoribulokinase / Uridine kinase family; | 98.58 | |
PRK11300 | 255 | livG leucine/isoleucine/valine transporter ATP-bin | 98.58 | |
cd03247 | 178 | ABCC_cytochrome_bd The CYD subfamily implicated in | 98.58 | |
cd03237 | 246 | ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o | 98.58 | |
PRK10575 | 265 | iron-hydroxamate transporter ATP-binding subunit; | 98.57 | |
cd03264 | 211 | ABC_drug_resistance_like ABC-type multidrug transp | 98.57 | |
COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 98.56 | |
cd03232 | 192 | ABC_PDR_domain2 The pleiotropic drug resistance-li | 98.55 | |
PRK13540 | 200 | cytochrome c biogenesis protein CcmA; Provisional | 98.55 | |
PRK11124 | 242 | artP arginine transporter ATP-binding subunit; Pro | 98.55 | |
PRK11831 | 269 | putative ABC transporter ATP-binding protein YrbF; | 98.54 | |
cd03263 | 220 | ABC_subfamily_A The ABCA subfamily mediates the tr | 98.54 | |
PRK14263 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 98.54 | |
cd03236 | 255 | ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o | 98.54 | |
PRK10908 | 222 | cell division protein FtsE; Provisional | 98.53 | |
cd03294 | 269 | ABC_Pro_Gly_Bertaine This family comprises the gly | 98.53 | |
PRK11231 | 255 | fecE iron-dicitrate transporter ATP-binding subuni | 98.53 | |
cd02025 | 220 | PanK Pantothenate kinase (PanK) catalyzes the phos | 98.52 | |
COG4988 | 559 | CydD ABC-type transport system involved in cytochr | 98.52 | |
PLN02772 | 398 | guanylate kinase | 98.52 | |
TIGR00968 | 237 | 3a0106s01 sulfate ABC transporter, ATP-binding pro | 98.52 | |
cd03235 | 213 | ABC_Metallic_Cations ABC component of the metal-ty | 98.52 | |
TIGR03797 | 686 | NHPM_micro_ABC2 NHPM bacteriocin system ABC transp | 98.51 | |
cd02026 | 273 | PRK Phosphoribulokinase (PRK) is an enzyme involve | 98.5 | |
cd03296 | 239 | ABC_CysA_sulfate_importer Part of the ABC transpor | 98.5 | |
cd03267 | 236 | ABC_NatA_like Similar in sequence to NatA, this is | 98.5 | |
PRK10070 | 400 | glycine betaine transporter ATP-binding subunit; P | 98.5 | |
cd03257 | 228 | ABC_NikE_OppD_transporters The ABC transporter sub | 98.49 | |
PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 98.49 | |
PRK11176 | 582 | lipid transporter ATP-binding/permease protein; Pr | 98.48 | |
PRK15079 | 331 | oligopeptide ABC transporter ATP-binding protein O | 98.48 | |
TIGR01193 | 708 | bacteriocin_ABC ABC-type bacteriocin transporter. | 98.48 | |
PRK10790 | 592 | putative multidrug transporter membrane\ATP-bindin | 98.48 | |
PRK15056 | 272 | manganese/iron transporter ATP-binding protein; Pr | 98.48 | |
PRK09536 | 402 | btuD corrinoid ABC transporter ATPase; Reviewed | 98.48 | |
PRK13647 | 274 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.47 | |
PRK14242 | 253 | phosphate transporter ATP-binding protein; Provisi | 98.47 | |
TIGR03796 | 710 | NHPM_micro_ABC1 NHPM bacteriocin system ABC transp | 98.47 | |
cd03217 | 200 | ABC_FeS_Assembly ABC-type transport system involve | 98.46 | |
TIGR03608 | 206 | L_ocin_972_ABC putative bacteriocin export ABC tra | 98.46 | |
PRK10418 | 254 | nikD nickel transporter ATP-binding protein NikD; | 98.46 | |
PRK14247 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.46 | |
PRK13633 | 280 | cobalt transporter ATP-binding subunit; Provisiona | 98.46 | |
PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 98.46 | |
PRK11248 | 255 | tauB taurine transporter ATP-binding subunit; Prov | 98.46 | |
COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 98.45 | |
PRK14268 | 258 | phosphate ABC transporter ATP-binding protein; Pro | 98.45 | |
cd03299 | 235 | ABC_ModC_like Archeal protein closely related to M | 98.45 | |
PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 98.45 | |
COG1127 | 263 | Ttg2A ABC-type transport system involved in resist | 98.45 | |
PRK10619 | 257 | histidine/lysine/arginine/ornithine transporter su | 98.45 | |
cd03224 | 222 | ABC_TM1139_LivF_branched LivF (TM1139) is part of | 98.44 | |
PRK13548 | 258 | hmuV hemin importer ATP-binding subunit; Provision | 98.44 | |
PRK13652 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.43 | |
PRK10895 | 241 | lipopolysaccharide ABC transporter ATP-binding pro | 98.43 | |
TIGR02857 | 529 | CydD thiol reductant ABC exporter, CydD subunit. U | 98.43 | |
PRK09580 | 248 | sufC cysteine desulfurase ATPase component; Review | 98.43 | |
TIGR00554 | 290 | panK_bact pantothenate kinase, bacterial type. Sho | 98.43 | |
cd03223 | 166 | ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass | 98.42 | |
cd03253 | 236 | ABCC_ATM1_transporter ATM1 is an ABC transporter t | 98.42 | |
PRK14259 | 269 | phosphate ABC transporter ATP-binding protein; Pro | 98.42 | |
cd02024 | 187 | NRK1 Nicotinamide riboside kinase (NRK) is an enzy | 98.42 | |
COG1117 | 253 | PstB ABC-type phosphate transport system, ATPase c | 98.42 | |
PRK10584 | 228 | putative ABC transporter ATP-binding protein YbbA; | 98.41 | |
PRK13639 | 275 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.41 | |
cd03254 | 229 | ABCC_Glucan_exporter_like Glucan exporter ATP-bind | 98.41 | |
cd02023 | 198 | UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. | 98.41 | |
PRK14738 | 206 | gmk guanylate kinase; Provisional | 98.41 | |
PRK14254 | 285 | phosphate ABC transporter ATP-binding protein; Pro | 98.41 | |
COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 98.4 | |
PRK09700 | 510 | D-allose transporter ATP-binding protein; Provisio | 98.4 | |
PRK13649 | 280 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.4 | |
PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 98.4 | |
COG3845 | 501 | ABC-type uncharacterized transport systems, ATPase | 98.4 | |
PRK13657 | 588 | cyclic beta-1,2-glucan ABC transporter; Provisiona | 98.4 | |
PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 98.4 | |
PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 98.4 | |
PRK13636 | 283 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.4 | |
PRK09473 | 330 | oppD oligopeptide transporter ATP-binding componen | 98.39 | |
TIGR01277 | 213 | thiQ thiamine ABC transporter, ATP-binding protein | 98.39 | |
PRK13632 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.39 | |
PRK15093 | 330 | antimicrobial peptide ABC transporter ATP-binding | 98.39 | |
PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 98.39 | |
PRK11614 | 237 | livF leucine/isoleucine/valine transporter ATP-bin | 98.38 | |
PRK08233 | 182 | hypothetical protein; Provisional | 98.38 | |
COG4555 | 245 | NatA ABC-type Na+ transport system, ATPase compone | 98.38 | |
COG4152 | 300 | ABC-type uncharacterized transport system, ATPase | 98.38 | |
PRK10253 | 265 | iron-enterobactin transporter ATP-binding protein; | 98.38 | |
PRK10771 | 232 | thiQ thiamine transporter ATP-binding subunit; Pro | 98.38 | |
COG4175 | 386 | ProV ABC-type proline/glycine betaine transport sy | 98.38 | |
PRK14245 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.38 | |
TIGR03410 | 230 | urea_trans_UrtE urea ABC transporter, ATP-binding | 98.38 | |
cd03260 | 227 | ABC_PstB_phosphate_transporter Phosphate uptake is | 98.38 | |
PRK11160 | 574 | cysteine/glutathione ABC transporter membrane/ATP- | 98.38 | |
TIGR01184 | 230 | ntrCD nitrate transport ATP-binding subunits C and | 98.37 | |
PRK13637 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.37 | |
PRK13635 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.37 | |
TIGR02769 | 265 | nickel_nikE nickel import ATP-binding protein NikE | 98.37 | |
PRK11701 | 258 | phnK phosphonate C-P lyase system protein PhnK; Pr | 98.37 | |
PRK13638 | 271 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.37 | |
PRK13541 | 195 | cytochrome c biogenesis protein CcmA; Provisional | 98.37 | |
PRK11174 | 588 | cysteine/glutathione ABC transporter membrane/ATP- | 98.36 | |
cd03290 | 218 | ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec | 98.36 | |
PRK13646 | 286 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.36 | |
PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 98.36 | |
cd03244 | 221 | ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. | 98.36 | |
PLN03232 | 1495 | ABC transporter C family member; Provisional | 98.36 | |
PRK13648 | 269 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.36 | |
TIGR03375 | 694 | type_I_sec_LssB type I secretion system ATPase, Ls | 98.36 | |
TIGR01978 | 243 | sufC FeS assembly ATPase SufC. SufC is part of the | 98.35 | |
PRK15112 | 267 | antimicrobial peptide ABC system ATP-binding prote | 98.35 | |
PRK10247 | 225 | putative ABC transporter ATP-binding protein YbbL; | 98.35 | |
PRK13645 | 289 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.35 | |
PRK13538 | 204 | cytochrome c biogenesis protein CcmA; Provisional | 98.35 | |
cd03245 | 220 | ABCC_bacteriocin_exporters ABC-type bacteriocin ex | 98.35 | |
COG1135 | 339 | AbcC ABC-type metal ion transport system, ATPase c | 98.34 | |
PRK13641 | 287 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.34 | |
cd03214 | 180 | ABC_Iron-Siderophores_B12_Hemin ABC transporters, | 98.34 | |
cd03250 | 204 | ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. | 98.34 | |
PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 98.34 | |
PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 98.34 | |
TIGR00972 | 247 | 3a0107s01c2 phosphate ABC transporter, ATP-binding | 98.34 | |
TIGR01842 | 544 | type_I_sec_PrtD type I secretion system ABC transp | 98.34 | |
cd03220 | 224 | ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo | 98.34 | |
PRK10419 | 268 | nikE nickel transporter ATP-binding protein NikE; | 98.33 | |
PRK13634 | 290 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.33 | |
PRK14250 | 241 | phosphate ABC transporter ATP-binding protein; Pro | 98.33 | |
TIGR00958 | 711 | 3a01208 Conjugate Transporter-2 (CT2) Family prote | 98.33 | |
PRK14258 | 261 | phosphate ABC transporter ATP-binding protein; Pro | 98.32 | |
cd03249 | 238 | ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) | 98.32 | |
TIGR01189 | 198 | ccmA heme ABC exporter, ATP-binding protein CcmA. | 98.32 | |
KOG3354|consensus | 191 | 98.32 | ||
PRK11288 | 501 | araG L-arabinose transporter ATP-binding protein; | 98.32 | |
smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 98.31 | |
PRK14260 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 98.31 | |
PRK13539 | 207 | cytochrome c biogenesis protein CcmA; Provisional | 98.31 | |
TIGR03415 | 382 | ABC_choXWV_ATP choline ABC transporter, ATP-bindin | 98.31 | |
COG4133 | 209 | CcmA ABC-type transport system involved in cytochr | 98.31 | |
PRK13643 | 288 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.3 | |
PRK14241 | 258 | phosphate transporter ATP-binding protein; Provisi | 98.3 | |
cd03252 | 237 | ABCC_Hemolysin The ABC-transporter hemolysin B is | 98.3 | |
PRK14265 | 274 | phosphate ABC transporter ATP-binding protein; Pro | 98.3 | |
TIGR01194 | 555 | cyc_pep_trnsptr cyclic peptide transporter. This m | 98.29 | |
COG4604 | 252 | CeuD ABC-type enterochelin transport system, ATPas | 98.29 | |
cd03300 | 232 | ABC_PotA_N PotA is an ABC-type transporter and the | 98.29 | |
PRK10762 | 501 | D-ribose transporter ATP binding protein; Provisio | 98.29 | |
PRK13543 | 214 | cytochrome c biogenesis protein CcmA; Provisional | 98.29 | |
PRK14267 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 98.29 | |
PRK11264 | 250 | putative amino-acid ABC transporter ATP-binding pr | 98.28 | |
TIGR03771 | 223 | anch_rpt_ABC anchored repeat-type ABC transporter, | 98.28 | |
PRK14270 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.28 | |
TIGR02770 | 230 | nickel_nikD nickel import ATP-binding protein NikD | 98.28 | |
PRK14269 | 246 | phosphate ABC transporter ATP-binding protein; Pro | 98.28 | |
TIGR02204 | 576 | MsbA_rel ABC transporter, permease/ATP-binding pro | 98.28 | |
COG4181 | 228 | Predicted ABC-type transport system involved in ly | 98.27 | |
PRK14256 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.27 | |
TIGR03005 | 252 | ectoine_ehuA ectoine/hydroxyectoine ABC transporte | 98.27 | |
TIGR00957 | 1522 | MRP_assoc_pro multi drug resistance-associated pro | 98.27 | |
TIGR03873 | 256 | F420-0_ABC_ATP proposed F420-0 ABC transporter, AT | 98.27 | |
PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 98.27 | |
PRK13651 | 305 | cobalt transporter ATP-binding subunit; Provisiona | 98.27 | |
cd03248 | 226 | ABCC_TAP TAP, the Transporter Associated with Anti | 98.27 | |
cd03251 | 234 | ABCC_MsbA MsbA is an essential ABC transporter, cl | 98.27 | |
PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 98.27 | |
TIGR02982 | 220 | heterocyst_DevA ABC exporter ATP-binding subunit, | 98.27 | |
TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 98.26 | |
COG4608 | 268 | AppF ABC-type oligopeptide transport system, ATPas | 98.26 | |
PTZ00243 | 1560 | ABC transporter; Provisional | 98.26 | |
PRK13549 | 506 | xylose transporter ATP-binding subunit; Provisiona | 98.26 | |
PRK05057 | 172 | aroK shikimate kinase I; Reviewed | 98.26 | |
PLN03130 | 1622 | ABC transporter C family member; Provisional | 98.26 | |
PRK15177 | 213 | Vi polysaccharide export ATP-binding protein VexC; | 98.26 | |
PRK11022 | 326 | dppD dipeptide transporter ATP-binding subunit; Pr | 98.25 | |
PRK14262 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.24 | |
cd03231 | 201 | ABC_CcmA_heme_exporter CcmA, the ATP-binding compo | 98.24 | |
cd03221 | 144 | ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is | 98.24 | |
PRK10522 | 547 | multidrug transporter membrane component/ATP-bindi | 98.23 | |
PRK13650 | 279 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.23 | |
TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 98.23 | |
TIGR01187 | 325 | potA spermidine/putrescine ABC transporter ATP-bin | 98.23 | |
TIGR03740 | 223 | galliderm_ABC gallidermin-class lantibiotic protec | 98.23 | |
COG0444 | 316 | DppD ABC-type dipeptide/oligopeptide/nickel transp | 98.23 | |
PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 98.23 | |
PRK11247 | 257 | ssuB aliphatic sulfonates transport ATP-binding su | 98.23 | |
PRK13547 | 272 | hmuV hemin importer ATP-binding subunit; Provision | 98.23 | |
cd03369 | 207 | ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty | 98.22 | |
PRK14235 | 267 | phosphate transporter ATP-binding protein; Provisi | 98.22 | |
PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 98.22 | |
PRK14264 | 305 | phosphate ABC transporter ATP-binding protein; Pro | 98.22 | |
PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 98.21 | |
TIGR02203 | 571 | MsbA_lipidA lipid A export permease/ATP-binding pr | 98.21 | |
TIGR02323 | 253 | CP_lyasePhnK phosphonate C-P lyase system protein | 98.21 | |
PRK13631 | 320 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.2 | |
PLN03211 | 659 | ABC transporter G-25; Provisional | 98.2 | |
PRK14274 | 259 | phosphate ABC transporter ATP-binding protein; Pro | 98.2 | |
TIGR02324 | 224 | CP_lyasePhnL phosphonate C-P lyase system protein | 98.2 | |
PRK13409 | 590 | putative ATPase RIL; Provisional | 98.2 | |
PRK14240 | 250 | phosphate transporter ATP-binding protein; Provisi | 98.2 | |
KOG0057|consensus | 591 | 98.19 | ||
PRK14248 | 268 | phosphate ABC transporter ATP-binding protein; Pro | 98.19 | |
PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 98.19 | |
PRK05439 | 311 | pantothenate kinase; Provisional | 98.19 | |
KOG0055|consensus | 1228 | 98.19 | ||
PRK14272 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.18 | |
PRK14731 | 208 | coaE dephospho-CoA kinase; Provisional | 98.18 | |
PRK14253 | 249 | phosphate ABC transporter ATP-binding protein; Pro | 98.18 | |
TIGR01257 | 2272 | rim_protein retinal-specific rim ABC transporter. | 98.18 | |
TIGR01846 | 694 | type_I_sec_HlyB type I secretion system ABC transp | 98.18 | |
PRK14255 | 252 | phosphate ABC transporter ATP-binding protein; Pro | 98.18 | |
PRK14244 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.17 | |
PRK14236 | 272 | phosphate transporter ATP-binding protein; Provisi | 98.17 | |
PRK11308 | 327 | dppF dipeptide transporter ATP-binding subunit; Pr | 98.17 | |
TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 98.17 | |
PRK14271 | 276 | phosphate ABC transporter ATP-binding protein; Pro | 98.16 | |
PRK14237 | 267 | phosphate transporter ATP-binding protein; Provisi | 98.16 | |
PRK00131 | 175 | aroK shikimate kinase; Reviewed | 98.16 | |
PRK13642 | 277 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.16 | |
COG4618 | 580 | ArpD ABC-type protease/lipase transport system, AT | 98.15 | |
PRK09544 | 251 | znuC high-affinity zinc transporter ATPase; Review | 98.15 | |
PRK03695 | 248 | vitamin B12-transporter ATPase; Provisional | 98.15 | |
PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 98.15 | |
KOG0058|consensus | 716 | 98.15 | ||
PRK06547 | 172 | hypothetical protein; Provisional | 98.15 | |
CHL00131 | 252 | ycf16 sulfate ABC transporter protein; Validated | 98.14 | |
PRK15134 | 529 | microcin C ABC transporter ATP-binding protein Yej | 98.14 | |
PRK14239 | 252 | phosphate transporter ATP-binding protein; Provisi | 98.14 | |
cd00267 | 157 | ABC_ATPase ABC (ATP-binding cassette) transporter | 98.14 | |
TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 98.14 | |
PRK14261 | 253 | phosphate ABC transporter ATP-binding protein; Pro | 98.14 | |
COG1122 | 235 | CbiO ABC-type cobalt transport system, ATPase comp | 98.13 | |
TIGR02633 | 500 | xylG D-xylose ABC transporter, ATP-binding protein | 98.13 | |
cd03288 | 257 | ABCC_SUR2 The SUR domain 2. The sulfonylurea recep | 98.13 | |
PRK13546 | 264 | teichoic acids export protein ATP-binding subunit; | 98.13 | |
COG1137 | 243 | YhbG ABC-type (unclassified) transport system, ATP | 98.13 | |
PRK13640 | 282 | cbiO cobalt transporter ATP-binding subunit; Provi | 98.12 | |
PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 98.12 | |
PRK14238 | 271 | phosphate transporter ATP-binding protein; Provisi | 98.12 | |
COG1134 | 249 | TagH ABC-type polysaccharide/polyol phosphate tran | 98.12 | |
PRK14251 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.11 | |
PRK14249 | 251 | phosphate ABC transporter ATP-binding protein; Pro | 98.1 | |
PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 98.1 | |
COG4615 | 546 | PvdE ABC-type siderophore export system, fused ATP | 98.1 | |
PRK14266 | 250 | phosphate ABC transporter ATP-binding protein; Pro | 98.1 | |
PRK09984 | 262 | phosphonate/organophosphate ester transporter subu | 98.09 | |
COG1123 | 539 | ATPase components of various ABC-type transport sy | 98.09 | |
PLN03073 | 718 | ABC transporter F family; Provisional | 98.09 | |
PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 98.08 | |
PRK14243 | 264 | phosphate transporter ATP-binding protein; Provisi | 98.08 | |
TIGR01192 | 585 | chvA glucan exporter ATP-binding protein. This mod | 98.08 | |
PRK07261 | 171 | topology modulation protein; Provisional | 98.07 | |
PRK14257 | 329 | phosphate ABC transporter ATP-binding protein; Pro | 98.07 | |
cd03289 | 275 | ABCC_CFTR2 The CFTR subfamily domain 2. The cystic | 98.06 | |
COG3265 | 161 | GntK Gluconate kinase [Carbohydrate transport and | 98.05 | |
cd03291 | 282 | ABCC_CFTR1 The CFTR subfamily domain 1. The cystic | 98.05 | |
COG4167 | 267 | SapF ABC-type antimicrobial peptide transport syst | 98.04 | |
COG1129 | 500 | MglA ABC-type sugar transport system, ATPase compo | 98.04 | |
PRK10938 | 490 | putative molybdenum transport ATP-binding protein | 98.04 | |
PRK10261 | 623 | glutathione transporter ATP-binding protein; Provi | 98.03 | |
PRK11147 | 635 | ABC transporter ATPase component; Reviewed | 98.03 | |
COG1101 | 263 | PhnK ABC-type uncharacterized transport system, AT | 98.02 | |
PRK08118 | 167 | topology modulation protein; Reviewed | 98.02 | |
PRK10636 | 638 | putative ABC transporter ATP-binding protein; Prov | 98.02 | |
TIGR03269 | 520 | met_CoM_red_A2 methyl coenzyme M reductase system, | 98.02 | |
PRK14275 | 286 | phosphate ABC transporter ATP-binding protein; Pro | 98.02 | |
PRK14246 | 257 | phosphate ABC transporter ATP-binding protein; Pro | 98.01 | |
PRK10535 | 648 | macrolide transporter ATP-binding /permease protei | 98.0 | |
cd03234 | 226 | ABCG_White The White subfamily represents ABC tran | 98.0 | |
PRK10982 | 491 | galactose/methyl galaxtoside transporter ATP-bindi | 98.0 | |
COG1123 | 539 | ATPase components of various ABC-type transport sy | 98.0 | |
COG4107 | 258 | PhnK ABC-type phosphonate transport system, ATPase | 98.0 | |
PRK15064 | 530 | ABC transporter ATP-binding protein; Provisional | 98.0 | |
PRK14252 | 265 | phosphate ABC transporter ATP-binding protein; Pro | 97.99 | |
PRK15439 | 510 | autoinducer 2 ABC transporter ATP-binding protein | 97.98 | |
TIGR03719 | 552 | ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa | 97.98 | |
KOG0054|consensus | 1381 | 97.98 | ||
PRK11819 | 556 | putative ABC transporter ATP-binding protein; Revi | 97.97 | |
PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 97.96 | |
TIGR01271 | 1490 | CFTR_protein cystic fibrosis transmembrane conduct | 97.96 | |
COG4136 | 213 | ABC-type uncharacterized transport system, ATPase | 97.96 | |
PRK13948 | 182 | shikimate kinase; Provisional | 97.96 | |
PLN02796 | 347 | D-glycerate 3-kinase | 97.95 | |
COG0488 | 530 | Uup ATPase components of ABC transporters with dup | 97.95 | |
COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 97.94 | |
TIGR01313 | 163 | therm_gnt_kin carbohydrate kinase, thermoresistant | 97.94 | |
TIGR00954 | 659 | 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA | 97.94 | |
PRK10789 | 569 | putative multidrug transporter membrane\ATP-bindin | 97.93 | |
PRK09825 | 176 | idnK D-gluconate kinase; Provisional | 97.93 | |
PRK06217 | 183 | hypothetical protein; Validated | 97.93 | |
PRK13949 | 169 | shikimate kinase; Provisional | 97.93 | |
PRK11545 | 163 | gntK gluconate kinase 1; Provisional | 97.9 | |
PRK14527 | 191 | adenylate kinase; Provisional | 97.89 | |
COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 97.89 | |
TIGR01663 | 526 | PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | 97.88 | |
PRK13477 | 512 | bifunctional pantoate ligase/cytidylate kinase; Pr | 97.88 | |
PRK13545 | 549 | tagH teichoic acids export protein ATP-binding sub | 97.87 | |
PRK06696 | 223 | uridine kinase; Validated | 97.87 | |
cd02020 | 147 | CMPK Cytidine monophosphate kinase (CMPK) catalyze | 97.86 | |
KOG0055|consensus | 1228 | 97.86 | ||
TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 97.86 | |
PRK07667 | 193 | uridine kinase; Provisional | 97.85 | |
PRK13946 | 184 | shikimate kinase; Provisional | 97.85 | |
COG1119 | 257 | ModF ABC-type molybdenum transport system, ATPase | 97.83 | |
COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 97.83 | |
KOG3308|consensus | 225 | 97.83 | ||
cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 97.81 | |
TIGR00017 | 217 | cmk cytidylate kinase. This family consists of cyt | 97.8 | |
COG0283 | 222 | Cmk Cytidylate kinase [Nucleotide transport and me | 97.79 | |
COG1245 | 591 | Predicted ATPase, RNase L inhibitor (RLI) homolog | 97.79 | |
PRK13409 | 590 | putative ATPase RIL; Provisional | 97.79 | |
PRK09270 | 229 | nucleoside triphosphate hydrolase domain-containin | 97.79 | |
PRK14530 | 215 | adenylate kinase; Provisional | 97.78 | |
PRK06762 | 166 | hypothetical protein; Provisional | 97.78 | |
TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 97.77 | |
COG4674 | 249 | Uncharacterized ABC-type transport system, ATPase | 97.77 | |
PRK12338 | 319 | hypothetical protein; Provisional | 97.77 | |
TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 97.77 | |
cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 97.77 | |
PLN03140 | 1470 | ABC transporter G family member; Provisional | 97.76 | |
cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 97.75 | |
COG4138 | 248 | BtuD ABC-type cobalamin transport system, ATPase c | 97.74 | |
PRK03839 | 180 | putative kinase; Provisional | 97.74 | |
COG4586 | 325 | ABC-type uncharacterized transport system, ATPase | 97.74 | |
PRK12337 | 475 | 2-phosphoglycerate kinase; Provisional | 97.73 | |
cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 97.7 | |
PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 97.7 | |
PTZ00265 | 1466 | multidrug resistance protein (mdr1); Provisional | 97.7 | |
KOG0056|consensus | 790 | 97.69 | ||
TIGR03238 | 504 | dnd_assoc_3 dnd system-associated protein 3. cereu | 97.69 | |
COG4778 | 235 | PhnL ABC-type phosphonate transport system, ATPase | 97.68 | |
PRK05541 | 176 | adenylylsulfate kinase; Provisional | 97.68 | |
cd00464 | 154 | SK Shikimate kinase (SK) is the fifth enzyme in th | 97.67 | |
COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 97.67 | |
cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 97.66 | |
PRK11860 | 661 | bifunctional 3-phosphoshikimate 1-carboxyvinyltran | 97.65 | |
COG4161 | 242 | ArtP ABC-type arginine transport system, ATPase co | 97.65 | |
PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 97.64 | |
COG1102 | 179 | Cmk Cytidylate kinase [Nucleotide transport and me | 97.63 | |
smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.63 | |
PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 97.62 | |
PRK13947 | 171 | shikimate kinase; Provisional | 97.6 | |
PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.6 | |
PLN03073 | 718 | ABC transporter F family; Provisional | 97.59 | |
PLN02200 | 234 | adenylate kinase family protein | 97.59 | |
PLN03130 | 1622 | ABC transporter C family member; Provisional | 97.59 | |
TIGR02173 | 171 | cyt_kin_arch cytidylate kinase, putative. Proteins | 97.59 | |
cd03272 | 243 | ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein | 97.58 | |
TIGR00955 | 617 | 3a01204 The Eye Pigment Precursor Transporter (EPP | 97.58 | |
PRK14730 | 195 | coaE dephospho-CoA kinase; Provisional | 97.58 | |
PRK14532 | 188 | adenylate kinase; Provisional | 97.58 | |
cd03273 | 251 | ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein | 97.58 | |
cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 97.56 | |
cd03274 | 212 | ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein | 97.56 | |
KOG0059|consensus | 885 | 97.55 | ||
cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 97.54 | |
PRK00889 | 175 | adenylylsulfate kinase; Provisional | 97.54 | |
PRK04182 | 180 | cytidylate kinase; Provisional | 97.53 | |
PRK00081 | 194 | coaE dephospho-CoA kinase; Reviewed | 97.52 | |
PLN03046 | 460 | D-glycerate 3-kinase; Provisional | 97.52 | |
PTZ00088 | 229 | adenylate kinase 1; Provisional | 97.51 | |
PRK14531 | 183 | adenylate kinase; Provisional | 97.51 | |
PHA02530 | 300 | pseT polynucleotide kinase; Provisional | 97.51 | |
PLN03232 | 1495 | ABC transporter C family member; Provisional | 97.5 | |
KOG0061|consensus | 613 | 97.48 | ||
PRK08154 | 309 | anaerobic benzoate catabolism transcriptional regu | 97.48 | |
cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 97.48 | |
PRK03731 | 171 | aroL shikimate kinase II; Reviewed | 97.48 | |
cd03278 | 197 | ABC_SMC_barmotin Barmotin is a tight junction-asso | 97.47 | |
TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 97.47 | |
COG4172 | 534 | ABC-type uncharacterized transport system, duplica | 97.47 | |
cd02022 | 179 | DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 | 97.47 | |
PRK03846 | 198 | adenylylsulfate kinase; Provisional | 97.45 | |
PRK01184 | 184 | hypothetical protein; Provisional | 97.44 | |
COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 97.44 | |
TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 97.43 | |
COG0645 | 170 | Predicted kinase [General function prediction only | 97.43 | |
TIGR00956 | 1394 | 3a01205 Pleiotropic Drug Resistance (PDR) Family p | 97.43 | |
PLN02199 | 303 | shikimate kinase | 97.42 | |
TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 97.41 | |
PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 97.41 | |
PRK04040 | 188 | adenylate kinase; Provisional | 97.41 | |
smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 97.39 | |
PRK14528 | 186 | adenylate kinase; Provisional | 97.39 | |
PRK00625 | 173 | shikimate kinase; Provisional | 97.39 | |
COG4598 | 256 | HisP ABC-type histidine transport system, ATPase c | 97.39 | |
PRK02496 | 184 | adk adenylate kinase; Provisional | 97.37 | |
PRK08356 | 195 | hypothetical protein; Provisional | 97.37 | |
PRK14021 | 542 | bifunctional shikimate kinase/3-dehydroquinate syn | 97.37 | |
PRK14733 | 204 | coaE dephospho-CoA kinase; Provisional | 97.36 | |
cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 97.34 | |
PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.34 | |
TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 97.34 | |
KOG0064|consensus | 728 | 97.34 | ||
PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 97.34 | |
PRK00279 | 215 | adk adenylate kinase; Reviewed | 97.32 | |
cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 97.31 | |
PRK00023 | 225 | cmk cytidylate kinase; Provisional | 97.3 |
>PRK14729 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Provisional | Back alignment and domain information |
---|
Probab=100.00 E-value=7e-70 Score=501.98 Aligned_cols=245 Identities=32% Similarity=0.485 Sum_probs=233.7 Q ss_pred CCeEEEEECCCchhHHHHHHHHHhhCCCeEeecCCceEeccccCCCCCCCHHHHcccccccccccCcCccchHHHHHHHH Q psy8556 36 RKTKVAILGPTASGKSSVALKISEYIPCEIISIDSALVYCDMDIGTNKPSIIEREITPHHLIDIIEPTKSYSVIQFCEDA 115 (298) Q Consensus 36 kg~iI~I~GpTGSGKSTLa~~La~~l~~~iis~Ds~qvy~g~~i~t~kp~~~e~~~v~~~l~~~~~~~e~~s~~~f~~~~ 115 (298) .+++|+|+||||||||.|+..||+. +++|||+||+|||+|++|+|+||+.+|+.+++|||++++++.+.||+++|.+.+ T Consensus 3 ~~~ii~I~GpTasGKS~LAl~LA~~-~~eIIsaDS~QvYr~ldIgTaKpt~eE~~~i~Hhlid~~~p~e~~sv~~f~~~a 81 (300) T PRK14729 3 ENKIVFIFGPTAVGKSNILFHFPKG-KAEIINVDSIQVYKEFDIASCKPSKELRKHIKHHLVDFLEPIKEYNLGIFYKEA 81 (300) T ss_pred CCcEEEEECCCccCHHHHHHHHHHh-CCcEEeccHHHHHCCCceecCCCCHHHHcCCCeeeeeccCCCCceeHHHHHHHH Confidence 4569999999999999999999999 689999999999999999999999999999999999999999999999999999 Q ss_pred HHhhHHHhhcCCceEEEchhHHHHHHHHccCCCCCCCCHHHHHHHHHHHHhhCHHHHHHHHhcCCccccC---------- Q psy8556 116 LFSIKNILKKKKLPLLVGGTMLYFKALRDGINKLPPANLKLRTKFNIDINKYGISFLYDKLKLLDPVTAN---------- 185 (298) Q Consensus 116 ~~~i~~i~~~~~~~IlvGGt~~y~~~ll~~~~~~p~~d~~lr~~l~~~~~~~g~~~l~~~L~~~Dp~~a~---------- 185 (298) .+.|++++.+|++||+||||++|++++++|+...|+.++++|.++.+.+...|...||+.|+++||++|+ T Consensus 82 ~~~i~~i~~~gk~PilvGGTglYi~all~gl~~~p~~~~~~r~~~~~~~~~~g~~~l~~~L~~~DP~~A~~i~pnd~~Ri 161 (300) T PRK14729 82 LKIIKELRQQKKIPIFVGGSAFYFKHLKYGLPSTPPVSSKIRIYVNNLFTLKGKSYLLEELKRVDFIRYESINKNDIYRI 161 (300) T ss_pred HHHHHHHHHCCCCEEEEeCchHHHHHHHcCCCCCCCCCHHHHHHHHHHHHhcCHHHHHHHHHhcCHHHHhhCCcCCHHHH Confidence 9999999999999999999999999999999888888999999999999999999999999999999988 Q ss_pred -------------------------------CCCChHHHHHHHHHHHHHHHhccchHHHHHHHHHhcCCCCCCCcccccC Q psy8556 186 -------------------------------QPSNRHILHKRISDRFKKMLDQDLLINEVKKIRKKWNLNLNLPSMKCIG 234 (298) Q Consensus 186 -------------------------------~~~~r~~L~~ri~~Rv~~M~~~G~l~~Ev~~l~~~~~~~~~~~~~~~IG 234 (298) +.+||++|++||++||+.|+++| |++||+.|++. +++.+.++|++|| T Consensus 162 ~RALEv~~~tG~~~s~~~~~~~~~~~~~~i~l~~~r~~L~~rI~~Rv~~Ml~~G-lieEv~~l~~~-~~~~~~~~~~aIG 239 (300) T PRK14729 162 KRSLEVYYQTGIPISQFLKKQNMFKNILAIGLKRPMEEMKSRIISRVNNMIDCG-LLSEIKSLLGK-GYNENTPAFKGIG 239 (300) T ss_pred HHHHHHHHHhCCChHhhhhccCCCCCeEEEEeCCCHHHHHHHHHHHHHHHHHCC-HHHHHHHHHhc-CCCCCCCcceeEc Confidence 33589999999999999999999 99999999987 6777899999999 Q ss_pred hhhHHHHH-cCCCCHHHHHHHHHHHHHHHHhHHHHHhcCCCCceeecCCC Q psy8556 235 YRQTWEYI-DGLIDRNTLKEKSIIATRQLAKQQLTWLRNMNEKITIDCLE 283 (298) Q Consensus 235 yke~~~~l-~g~~~~~~~~~~~~~~tr~yakrQ~twfr~~~~~~~~~~~~ 283 (298) |||+++|| .|+++++++++.++++||||||||+||||++++++|++.++ T Consensus 240 YkE~~~yl~~g~~~l~e~~e~i~~~Tr~yAKRQ~TWfr~~~~~~w~~~~~ 289 (300) T PRK14729 240 YREFLLWKSRPCYMLNDIINLIVKNSFLYVKRQMTFFAKIPNVLWFHPDD 289 (300) T ss_pred HHHHHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHcCCCCCCeeecCCC Confidence 99999999 89999999999999999999999999999999999998753 |
|
>COG0324 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
---|
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) | Back alignment and domain information |
---|
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
---|
>PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
---|
>PLN02748 tRNA dimethylallyltransferase | Back alignment and domain information |
---|
>PF01715 IPPT: IPP transferase; InterPro: IPR002627 tRNA isopentenyltransferases 2 | Back alignment and domain information |
---|
>PLN02165 adenylate isopentenyltransferase | Back alignment and domain information |
---|
>KOG1384|consensus | Back alignment and domain information |
---|
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] | Back alignment and domain information |
---|
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
---|
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
---|
>PRK00300 gmk guanylate kinase; Provisional | Back alignment and domain information |
---|
>TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
---|
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>PTZ00301 uridine kinase; Provisional | Back alignment and domain information |
---|
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] | Back alignment and domain information |
---|
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
---|
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
---|
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane | Back alignment and domain information |
---|
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup | Back alignment and domain information |
---|
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system | Back alignment and domain information |
---|
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
---|
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>PRK15453 phosphoribulokinase; Provisional | Back alignment and domain information |
---|
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>PRK05480 uridine/cytidine kinase; Provisional | Back alignment and domain information |
---|
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment | Back alignment and domain information |
---|
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein | Back alignment and domain information |
---|
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) | Back alignment and domain information |
---|
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional | Back alignment and domain information |
---|
>TIGR02673 FtsE cell division ATP-binding protein FtsE | Back alignment and domain information |
---|
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity | Back alignment and domain information |
---|
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
---|
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively | Back alignment and domain information |
---|
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport | Back alignment and domain information |
---|
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PLN02348 phosphoribulokinase | Back alignment and domain information |
---|
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
---|
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
---|
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
---|
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
---|
>PRK13536 nodulation factor exporter subunit NodI; Provisional | Back alignment and domain information |
---|
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin | Back alignment and domain information |
---|
>PLN02318 phosphoribulokinase/uridine kinase | Back alignment and domain information |
---|
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein | Back alignment and domain information |
---|
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit | Back alignment and domain information |
---|
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain | Back alignment and domain information |
---|
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
---|
>PRK04220 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
---|
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
---|
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids | Back alignment and domain information |
---|
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment | Back alignment and domain information |
---|
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK | Back alignment and domain information |
---|
>TIGR00235 udk uridine kinase | Back alignment and domain information |
---|
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively | Back alignment and domain information |
---|
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed | Back alignment and domain information |
---|
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
---|
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine | Back alignment and domain information |
---|
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake | Back alignment and domain information |
---|
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT | Back alignment and domain information |
---|
>PRK13537 nodulation ABC transporter NodI; Provisional | Back alignment and domain information |
---|
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
---|
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) | Back alignment and domain information |
---|
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance | Back alignment and domain information |
---|
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI | Back alignment and domain information |
---|
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) | Back alignment and domain information |
---|
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity | Back alignment and domain information |
---|
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP | Back alignment and domain information |
---|
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
---|
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD | Back alignment and domain information |
---|
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
---|
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit | Back alignment and domain information |
---|
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
---|
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids | Back alignment and domain information |
---|
>PRK07429 phosphoribulokinase; Provisional | Back alignment and domain information |
---|
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB | Back alignment and domain information |
---|
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] | Back alignment and domain information |
---|
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit | Back alignment and domain information |
---|
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
---|
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
---|
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA | Back alignment and domain information |
---|
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota | Back alignment and domain information |
---|
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PF00485 PRK: Phosphoribulokinase / Uridine kinase family; InterPro: IPR006083 Phosphoribulokinase (PRK) 2 | Back alignment and domain information |
---|
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis | Back alignment and domain information |
---|
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor | Back alignment and domain information |
---|
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component | Back alignment and domain information |
---|
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
---|
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters | Back alignment and domain information |
---|
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
---|
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional | Back alignment and domain information |
---|
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds | Back alignment and domain information |
---|
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor | Back alignment and domain information |
---|
>PRK10908 cell division protein FtsE; Provisional | Back alignment and domain information |
---|
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea | Back alignment and domain information |
---|
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway | Back alignment and domain information |
---|
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
---|
>PLN02772 guanylate kinase | Back alignment and domain information |
---|
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters | Back alignment and domain information |
---|
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes | Back alignment and domain information |
---|
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import | Back alignment and domain information |
---|
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake | Back alignment and domain information |
---|
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) | Back alignment and domain information |
---|
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
---|
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional | Back alignment and domain information |
---|
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional | Back alignment and domain information |
---|
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter | Back alignment and domain information |
---|
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
---|
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed | Back alignment and domain information |
---|
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK14242 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein | Back alignment and domain information |
---|
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component | Back alignment and domain information |
---|
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group | Back alignment and domain information |
---|
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional | Back alignment and domain information |
---|
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK13633 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
---|
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>cd03299 ABC_ModC_like Archeal protein closely related to ModC | Back alignment and domain information |
---|
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
---|
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
---|
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional | Back alignment and domain information |
---|
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids | Back alignment and domain information |
---|
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit | Back alignment and domain information |
---|
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed | Back alignment and domain information |
---|
>TIGR00554 panK_bact pantothenate kinase, bacterial type | Back alignment and domain information |
---|
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome | Back alignment and domain information |
---|
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria | Back alignment and domain information |
---|
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) | Back alignment and domain information |
---|
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional | Back alignment and domain information |
---|
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein | Back alignment and domain information |
---|
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 | Back alignment and domain information |
---|
>PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
---|
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
---|
>PRK09700 D-allose transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] | Back alignment and domain information |
---|
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional | Back alignment and domain information |
---|
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional | Back alignment and domain information |
---|
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
---|
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
---|
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
---|
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE | Back alignment and domain information |
---|
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient | Back alignment and domain information |
---|
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
---|
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D | Back alignment and domain information |
---|
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE | Back alignment and domain information |
---|
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional | Back alignment and domain information |
---|
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
---|
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed | Back alignment and domain information |
---|
>cd03290 ABCC_SUR1_N The SUR domain 1 | Back alignment and domain information |
---|
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
---|
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C | Back alignment and domain information |
---|
>PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
---|
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family | Back alignment and domain information |
---|
>TIGR01978 sufC FeS assembly ATPase SufC | Back alignment and domain information |
---|
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional | Back alignment and domain information |
---|
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional | Back alignment and domain information |
---|
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
---|
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters | Back alignment and domain information |
---|
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea | Back alignment and domain information |
---|
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C | Back alignment and domain information |
---|
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
---|
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
---|
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family | Back alignment and domain information |
---|
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export | Back alignment and domain information |
---|
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional | Back alignment and domain information |
---|
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein | Back alignment and domain information |
---|
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 | Back alignment and domain information |
---|
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA | Back alignment and domain information |
---|
>KOG3354|consensus | Back alignment and domain information |
---|
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
---|
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
---|
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
---|
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK14241 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E | Back alignment and domain information |
---|
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter | Back alignment and domain information |
---|
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D | Back alignment and domain information |
---|
>PRK10762 D-ribose transporter ATP binding protein; Provisional | Back alignment and domain information |
---|
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional | Back alignment and domain information |
---|
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional | Back alignment and domain information |
---|
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit | Back alignment and domain information |
---|
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD | Back alignment and domain information |
---|
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein | Back alignment and domain information |
---|
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
---|
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) | Back alignment and domain information |
---|
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK13651 cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules | Back alignment and domain information |
---|
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins | Back alignment and domain information |
---|
>PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family | Back alignment and domain information |
---|
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
---|
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>PTZ00243 ABC transporter; Provisional | Back alignment and domain information |
---|
>PRK13549 xylose transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK05057 aroK shikimate kinase I; Reviewed | Back alignment and domain information |
---|
>PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
---|
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional | Back alignment and domain information |
---|
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter | Back alignment and domain information |
---|
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth | Back alignment and domain information |
---|
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional | Back alignment and domain information |
---|
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
---|
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit | Back alignment and domain information |
---|
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit | Back alignment and domain information |
---|
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
---|
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) | Back alignment and domain information |
---|
>PRK14235 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
---|
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA | Back alignment and domain information |
---|
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK | Back alignment and domain information |
---|
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PLN03211 ABC transporter G-25; Provisional | Back alignment and domain information |
---|
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL | Back alignment and domain information |
---|
>PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
---|
>PRK14240 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>KOG0057|consensus | Back alignment and domain information |
---|
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
---|
>PRK05439 pantothenate kinase; Provisional | Back alignment and domain information |
---|
>KOG0055|consensus | Back alignment and domain information |
---|
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK14731 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
---|
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR01257 rim_protein retinal-specific rim ABC transporter | Back alignment and domain information |
---|
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family | Back alignment and domain information |
---|
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK14236 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
---|
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK14237 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
---|
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] | Back alignment and domain information |
---|
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed | Back alignment and domain information |
---|
>PRK03695 vitamin B12-transporter ATPase; Provisional | Back alignment and domain information |
---|
>PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>KOG0058|consensus | Back alignment and domain information |
---|
>PRK06547 hypothetical protein; Provisional | Back alignment and domain information |
---|
>CHL00131 ycf16 sulfate ABC transporter protein; Validated | Back alignment and domain information |
---|
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional | Back alignment and domain information |
---|
>PRK14239 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules | Back alignment and domain information |
---|
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein | Back alignment and domain information |
---|
>cd03288 ABCC_SUR2 The SUR domain 2 | Back alignment and domain information |
---|
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] | Back alignment and domain information |
---|
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
---|
>PRK14238 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
---|
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
---|
>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional | Back alignment and domain information |
---|
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
---|
>PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
---|
>PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK14243 phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR01192 chvA glucan exporter ATP-binding protein | Back alignment and domain information |
---|
>PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
---|
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 | Back alignment and domain information |
---|
>COG3265 GntK Gluconate kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
---|
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 | Back alignment and domain information |
---|
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
---|
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] | Back alignment and domain information |
---|
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional | Back alignment and domain information |
---|
>PRK10261 glutathione transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK11147 ABC transporter ATPase component; Reviewed | Back alignment and domain information |
---|
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
---|
>PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
---|
>PRK10636 putative ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 | Back alignment and domain information |
---|
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional | Back alignment and domain information |
---|
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors | Back alignment and domain information |
---|
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] | Back alignment and domain information |
---|
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>PRK15064 ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
---|
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional | Back alignment and domain information |
---|
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family | Back alignment and domain information |
---|
>KOG0054|consensus | Back alignment and domain information |
---|
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed | Back alignment and domain information |
---|
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
---|
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) | Back alignment and domain information |
---|
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
---|
>PRK13948 shikimate kinase; Provisional | Back alignment and domain information |
---|
>PLN02796 D-glycerate 3-kinase | Back alignment and domain information |
---|
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] | Back alignment and domain information |
---|
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
---|
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family | Back alignment and domain information |
---|
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei | Back alignment and domain information |
---|
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional | Back alignment and domain information |
---|
>PRK09825 idnK D-gluconate kinase; Provisional | Back alignment and domain information |
---|
>PRK06217 hypothetical protein; Validated | Back alignment and domain information |
---|
>PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
---|
>PRK11545 gntK gluconate kinase 1; Provisional | Back alignment and domain information |
---|
>PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
---|
>COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase | Back alignment and domain information |
---|
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional | Back alignment and domain information |
---|
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional | Back alignment and domain information |
---|
>PRK06696 uridine kinase; Validated | Back alignment and domain information |
---|
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor | Back alignment and domain information |
---|
>KOG0055|consensus | Back alignment and domain information |
---|
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
---|
>PRK07667 uridine kinase; Provisional | Back alignment and domain information |
---|
>PRK13946 shikimate kinase; Provisional | Back alignment and domain information |
---|
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>KOG3308|consensus | Back alignment and domain information |
---|
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
---|
>TIGR00017 cmk cytidylate kinase | Back alignment and domain information |
---|
>COG0283 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] | Back alignment and domain information |
---|
>PRK13409 putative ATPase RIL; Provisional | Back alignment and domain information |
---|
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed | Back alignment and domain information |
---|
>PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
---|
>PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
---|
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
---|
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] | Back alignment and domain information |
---|
>PRK12338 hypothetical protein; Provisional | Back alignment and domain information |
---|
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
---|
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
---|
>PLN03140 ABC transporter G family member; Provisional | Back alignment and domain information |
---|
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
---|
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] | Back alignment and domain information |
---|
>PRK03839 putative kinase; Provisional | Back alignment and domain information |
---|
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] | Back alignment and domain information |
---|
>PRK12337 2-phosphoglycerate kinase; Provisional | Back alignment and domain information |
---|
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
---|
>PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
---|
>PTZ00265 multidrug resistance protein (mdr1); Provisional | Back alignment and domain information |
---|
>KOG0056|consensus | Back alignment and domain information |
---|
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 | Back alignment and domain information |
---|
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
---|
>PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
---|
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants | Back alignment and domain information |
---|
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
---|
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional | Back alignment and domain information |
---|
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
---|
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
---|
>smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
---|
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
---|
>PRK13947 shikimate kinase; Provisional | Back alignment and domain information |
---|
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
---|
>PLN03073 ABC transporter F family; Provisional | Back alignment and domain information |
---|
>PLN02200 adenylate kinase family protein | Back alignment and domain information |
---|
>PLN03130 ABC transporter C family member; Provisional | Back alignment and domain information |
---|
>TIGR02173 cyt_kin_arch cytidylate kinase, putative | Back alignment and domain information |
---|
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
---|
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein | Back alignment and domain information |
---|
>PRK14730 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
---|
>PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
---|
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
---|
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
---|
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains | Back alignment and domain information |
---|
>KOG0059|consensus | Back alignment and domain information |
---|
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
---|
>PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
---|
>PRK04182 cytidylate kinase; Provisional | Back alignment and domain information |
---|
>PRK00081 coaE dephospho-CoA kinase; Reviewed | Back alignment and domain information |
---|
>PLN03046 D-glycerate 3-kinase; Provisional | Back alignment and domain information |
---|
>PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
---|
>PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
---|
>PHA02530 pseT polynucleotide kinase; Provisional | Back alignment and domain information |
---|
>PLN03232 ABC transporter C family member; Provisional | Back alignment and domain information |
---|
>KOG0061|consensus | Back alignment and domain information |
---|
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed | Back alignment and domain information |
---|
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
---|
>PRK03731 aroL shikimate kinase II; Reviewed | Back alignment and domain information |
---|
>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function | Back alignment and domain information |
---|
>TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
---|
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] | Back alignment and domain information |
---|
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 | Back alignment and domain information |
---|
>PRK03846 adenylylsulfate kinase; Provisional | Back alignment and domain information |
---|
>PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
---|
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
---|
>TIGR01351 adk adenylate kinases | Back alignment and domain information |
---|
>COG0645 Predicted kinase [General function prediction only] | Back alignment and domain information |
---|
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein | Back alignment and domain information |
---|
>PLN02199 shikimate kinase | Back alignment and domain information |
---|
>TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
---|
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
---|
>PRK04040 adenylate kinase; Provisional | Back alignment and domain information |
---|
>smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
---|
>PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
---|
>PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
---|
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
---|
>PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
---|
>PRK08356 hypothetical protein; Provisional | Back alignment and domain information |
---|
>PRK14021 bifunctional shikimate kinase/3-dehydroquinate synthase; Provisional | Back alignment and domain information |
---|
>PRK14733 coaE dephospho-CoA kinase; Provisional | Back alignment and domain information |
---|
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
---|
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
---|
>TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
---|
>KOG0064|consensus | Back alignment and domain information |
---|
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
---|
>PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
---|
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
---|
>PRK00023 cmk cytidylate kinase; Provisional | Back alignment and domain information |
---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
ID | Alignment Graph | Length | Definition | E-value | |
Query | 298 | ||||
3foz_A | 316 | Structure Of E. Coli Isopentenyl-Trna Transferase I | 2e-49 | ||
3crm_A | 323 | Structure Of Trna Dimethylallyltransferase: Rna Mod | 3e-47 | ||
2zm5_A | 316 | Crystal Structure Of Trna Modification Enzyme Miaa | 4e-46 | ||
2qgn_A | 322 | Crystal Structure Of Trna Isopentenylpyrophosphate | 1e-26 | ||
3d3q_A | 340 | Crystal Structure Of Trna Delta(2)-Isopentenylpyrop | 2e-16 | ||
3eph_A | 409 | Crystallographic Snapshots Of Eukaryotic Dimethylal | 2e-15 | ||
3a8t_A | 339 | Plant Adenylate Isopentenyltransferase In Complex W | 2e-09 |
>pdb|3FOZ|A Chain A, Structure Of E. Coli Isopentenyl-Trna Transferase In Complex With E. Coli Trna(Phe) Length = 316 | Back alignment and structure |
|
>pdb|3CRM|A Chain A, Structure Of Trna Dimethylallyltransferase: Rna Modification Through A Channel Length = 323 | Back alignment and structure |
>pdb|2ZM5|A Chain A, Crystal Structure Of Trna Modification Enzyme Miaa In The Complex With Trna(Phe) Length = 316 | Back alignment and structure |
>pdb|2QGN|A Chain A, Crystal Structure Of Trna Isopentenylpyrophosphate Transferase (Bh2366) From Bacillus Halodurans, Northeast Structural Genomics Consortium Target Bhr41. Length = 322 | Back alignment and structure |
>pdb|3D3Q|A Chain A, Crystal Structure Of Trna Delta(2)-Isopentenylpyrophosphate Transferase (Se0981) From Staphylococcus Epidermidis. Northeast Structural Genomics Consortium Target Ser100 Length = 340 | Back alignment and structure |
>pdb|3EPH|A Chain A, Crystallographic Snapshots Of Eukaryotic Dimethylallyltransferase Acting On Trna: Insight Into Trna Recognition And Reaction Mechanism Length = 409 | Back alignment and structure |
>pdb|3A8T|A Chain A, Plant Adenylate Isopentenyltransferase In Complex With Atp Length = 339 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
ID | Alignment Graph | Length | Definition | E-value |
Query | 298 | |||
3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 1e-108 | |
3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 1e-108 | |
3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 3e-97 | |
3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 4e-90 | |
3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 9e-89 | |
3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 7e-73 | |
2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 8e-54 | |
1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-09 | |
1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-05 | |
1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 8e-04 |
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Length = 316 | Back alignment and structure |
---|
Score = 316 bits (812), Expect = e-108 Identities = 104/307 (33%), Positives = 169/307 (55%), Gaps = 46/307 (14%) Query: 36 RKTKVAILGPTASGKSSVALKISEYIPCEIISIDSALVYCDMDIGTNKPSIIEREITPHH 95 + ++GPTASGK+++A+++ + +P E+IS+DSAL+Y MDIGT KP+ E PH Sbjct: 9 LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHR 68 Query: 96 LIDIIEPTKSYSVIQFCEDALFSIKNILKKKKLPLLVGGTMLYFKALRDGINKLPPANLK 155 L+DI +P+++YS F DAL + +I ++PLLVGGTMLYFKAL +G++ LP A+ + Sbjct: 69 LLDIRDPSQAYSAADFRRDALAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPE 128 Query: 156 LRTKFNIDINKYGISFLYDKLKLLDPVTANQ----------------------------- 186 +R + + G L+ +L+ +DPV A + Sbjct: 129 VRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRLSRALEVFFISGKTLTELTQT 188 Query: 187 ---------------PSNRHILHKRISDRFKKMLDQDLLINEVKKIRKKWNLNLNLPSMK 231 P++R +LH+RI RF +ML EV+ + + +L+ +LPS++ Sbjct: 189 SGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASGFE-AEVRALFARGDLHTDLPSIR 247 Query: 232 CIGYRQTWEYIDGLIDRNTLKEKSIIATRQLAKQQLTWLRNMNEKITIDCLEKNCV-QKI 290 C+GYRQ W Y++G I + + + + ATRQLAK+Q+TWLR +D + ++ Sbjct: 248 CVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARDEV 307 Query: 291 LNLIKDI 297 L ++ I Sbjct: 308 LQVVGAI 314 |
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Length = 323 | Back alignment and structure |
---|
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Length = 322 | Back alignment and structure |
---|
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Length = 340 | Back alignment and structure |
---|
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Length = 409 | Back alignment and structure |
---|
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Length = 339 | Back alignment and structure |
---|
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Length = 253 | Back alignment and structure |
---|
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
---|
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
---|
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
---|
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Length = 201 | Back alignment and structure |
---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
ID | Alignment Graph | Length | Definition | Probability |
Query | 298 | |||
3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 100.0 | |
3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 100.0 | |
3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 100.0 | |
3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 100.0 | |
3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 100.0 | |
3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 100.0 | |
2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 99.96 | |
2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 99.14 | |
1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 98.98 | |
3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 98.98 | |
3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 98.91 | |
3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 98.91 | |
3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 98.9 | |
2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 98.88 | |
3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 98.87 | |
2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 98.87 | |
4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 98.87 | |
1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 98.84 | |
3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 98.84 | |
2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 98.82 | |
2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 98.81 | |
3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 98.79 | |
2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 98.79 | |
1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 98.79 | |
1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 98.78 | |
1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 98.77 | |
3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 98.75 | |
3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 98.73 | |
2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 98.72 | |
1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 98.71 | |
1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 98.68 | |
1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 98.67 | |
1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 98.66 | |
3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 98.65 | |
1g6h_A | 257 | High-affinity branched-chain amino acid transport | 98.64 | |
3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 98.62 | |
1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 98.62 | |
2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 98.61 | |
2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 98.56 | |
3b5x_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.56 | |
2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 98.56 | |
2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 98.54 | |
2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 98.54 | |
2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 98.53 | |
3b60_A | 582 | Lipid A export ATP-binding/permease protein MSBA; | 98.52 | |
1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 98.51 | |
2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 98.5 | |
2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 98.47 | |
2yl4_A | 595 | ATP-binding cassette SUB-family B member 10, mitoc | 98.44 | |
2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 98.44 | |
2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 98.42 | |
2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 98.38 | |
3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 98.38 | |
1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 98.34 | |
3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 98.33 | |
1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 98.32 | |
3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 98.32 | |
3qf4_B | 598 | Uncharacterized ABC transporter ATP-binding prote | 98.3 | |
4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 98.3 | |
1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 98.25 | |
1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 98.25 | |
4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 98.24 | |
4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 98.23 | |
2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 98.23 | |
3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 98.22 | |
1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 98.22 | |
3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 98.2 | |
1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 98.2 | |
4a82_A | 578 | Cystic fibrosis transmembrane conductance regulat; | 98.19 | |
3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 98.18 | |
3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 98.17 | |
1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 98.17 | |
3qf4_A | 587 | ABC transporter, ATP-binding protein; multidrug tr | 98.15 | |
3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 98.14 | |
2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 98.12 | |
3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 98.1 | |
2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 98.1 | |
1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 98.09 | |
2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 98.09 | |
3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 98.08 | |
2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 98.07 | |
1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 98.07 | |
2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 98.06 | |
4f4c_A | 1321 | Multidrug resistance protein PGP-1; ABC transporte | 98.06 | |
3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 98.05 | |
1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 98.04 | |
3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 98.04 | |
3zvl_A | 416 | Bifunctional polynucleotide phosphatase/kinase; hy | 98.02 | |
1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 98.01 | |
1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 98.0 | |
1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 97.99 | |
3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 97.99 | |
3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 97.99 | |
3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 97.98 | |
2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 97.98 | |
1a7j_A | 290 | Phosphoribulokinase; transferase, calvin cycle; 2. | 97.98 | |
2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 97.98 | |
1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 97.97 | |
2og2_A | 359 | Putative signal recognition particle receptor; nuc | 97.97 | |
3euj_A | 483 | Chromosome partition protein MUKB, linker; MUKB, M | 97.96 | |
3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 97.96 | |
2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 97.96 | |
2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 97.95 | |
1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 97.95 | |
1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 97.95 | |
2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 97.95 | |
2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 97.95 | |
1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 97.94 | |
3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 97.93 | |
4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 97.93 | |
1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 97.92 | |
2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 97.92 | |
1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 97.92 | |
2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 97.91 | |
3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 97.91 | |
3ozx_A | 538 | RNAse L inhibitor; ATP binding cassette protein, h | 97.9 | |
1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 97.89 | |
3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 97.89 | |
3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 97.89 | |
1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 97.88 | |
3j16_B | 608 | RLI1P; ribosome recycling, translation, eukarya, r | 97.87 | |
3g5u_A | 1284 | MCG1178, multidrug resistance protein 1A; P-glycop | 97.87 | |
3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 97.86 | |
3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 97.86 | |
2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 97.86 | |
1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 97.85 | |
2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 97.85 | |
2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 97.85 | |
1yqt_A | 538 | RNAse L inhibitor; ATP-binding cassette, ribosome | 97.84 | |
3bk7_A | 607 | ABC transporter ATP-binding protein; ABC ATPase, i | 97.84 | |
3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 97.84 | |
1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 97.83 | |
3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 97.83 | |
2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 97.83 | |
2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 97.82 | |
2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 97.81 | |
1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 97.81 | |
4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 97.8 | |
2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 97.8 | |
2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 97.8 | |
1via_A | 175 | Shikimate kinase; structural genomics, transferase | 97.8 | |
1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 97.79 | |
1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 97.79 | |
2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 97.79 | |
1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 97.79 | |
2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 97.79 | |
1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 97.78 | |
2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 97.77 | |
1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 97.77 | |
1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 97.76 | |
2obl_A | 347 | ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O | 97.76 | |
1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 97.75 | |
3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 97.75 | |
2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 97.74 | |
1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 97.73 | |
2vp4_A | 230 | Deoxynucleoside kinase; ATP-binding, DNA synthesis | 97.73 | |
2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.72 | |
3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.72 | |
3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 97.72 | |
2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 97.71 | |
3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 97.71 | |
1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 97.7 | |
1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 97.69 | |
2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 97.69 | |
3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 97.68 | |
2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 97.68 | |
1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 97.67 | |
1qhl_A | 227 | Protein (cell division protein MUKB); SMC, chromos | 97.67 | |
3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 97.67 | |
3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 97.66 | |
2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 97.66 | |
2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 97.65 | |
2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 97.62 | |
1t9h_A | 307 | YLOQ, probable GTPase ENGC; N-terminal beta-barrel | 97.61 | |
1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 97.61 | |
1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 97.61 | |
1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 97.6 | |
2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 97.59 | |
3szr_A | 608 | Interferon-induced GTP-binding protein MX1; interf | 97.57 | |
2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 97.57 | |
2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 97.56 | |
3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 97.55 | |
1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 97.55 | |
2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 97.54 | |
2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 97.54 | |
1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 97.54 | |
2h92_A | 219 | Cytidylate kinase; rossmann fold, transferase; HET | 97.53 | |
2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 97.51 | |
2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.51 | |
1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 97.5 | |
3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 97.49 | |
2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 97.48 | |
1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 97.47 | |
1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 97.46 | |
2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 97.45 | |
2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.44 | |
1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 97.43 | |
3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 97.42 | |
2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 97.42 | |
1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 97.41 | |
1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 97.41 | |
1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 97.4 | |
2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 97.39 | |
2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 97.38 | |
1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.37 | |
3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 97.36 | |
3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 97.36 | |
1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 97.34 | |
1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 97.33 | |
1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 97.31 | |
2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 97.3 | |
1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 97.27 | |
1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 97.27 | |
1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 97.26 | |
1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.24 | |
4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 97.23 | |
2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 97.22 | |
2iw3_A | 986 | Elongation factor 3A; acetylation, ATP-binding, pr | 97.21 | |
3bos_A | 242 | Putative DNA replication factor; P-loop containing | 97.2 | |
1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 97.19 | |
3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.17 | |
2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 97.16 | |
3hdt_A | 223 | Putative kinase; structura genomics, PSI-2, protei | 97.1 | |
1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 97.09 | |
3fdi_A | 201 | Uncharacterized protein; cytidylate kinase like pr | 97.09 | |
4aby_A | 415 | DNA repair protein RECN; hydrolase, double strand | 97.09 | |
1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 97.08 | |
1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 97.07 | |
1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 97.06 | |
3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 97.06 | |
1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 97.03 | |
1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.03 | |
3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.01 | |
3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.0 | |
3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.0 | |
3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 96.98 | |
1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 96.97 | |
1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 96.97 | |
1ewq_A | 765 | DNA mismatch repair protein MUTS; multiple domains | 96.95 | |
2o8b_B | 1022 | DNA mismatch repair protein MSH6; DNA damage respo | 96.92 | |
3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 96.92 | |
4i1u_A | 210 | Dephospho-COA kinase; structural genomics, niaid, | 96.92 | |
3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 96.91 | |
2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.89 | |
1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 96.88 | |
3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 96.88 | |
2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 96.87 | |
2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.86 | |
2ocp_A | 241 | DGK, deoxyguanosine kinase; protein-nucleotide com | 96.85 | |
1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 96.84 | |
3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 96.84 | |
1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 96.84 | |
3ux8_A | 670 | Excinuclease ABC, A subunit; UVRA, nucleotide exci | 96.84 | |
3qkt_A | 339 | DNA double-strand break repair RAD50 ATPase; RECA- | 96.83 | |
1w1w_A | 430 | Structural maintenance of chromosome 1; cohesin, c | 96.83 | |
2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 96.82 | |
1wb9_A | 800 | DNA mismatch repair protein MUTS; DNA-binding, ATP | 96.81 | |
4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 96.8 | |
3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 96.79 | |
2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 96.78 | |
1ni3_A | 392 | YCHF GTPase, YCHF GTP-binding protein; structural | 96.75 | |
1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.74 | |
1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.72 | |
3thx_B | 918 | DNA mismatch repair protein MSH3; ABC family ATPas | 96.71 | |
3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.71 | |
2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 96.69 | |
3tmk_A | 216 | Thymidylate kinase; phosphotransferase; HET: T5A; | 96.68 | |
3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 96.67 | |
1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 96.65 | |
2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 96.65 | |
1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.64 | |
2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 96.62 | |
2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 96.61 | |
4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 96.6 | |
2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.59 | |
4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 96.59 | |
2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 96.58 | |
3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 96.57 | |
2o5v_A | 359 | DNA replication and repair protein RECF; ABC ATPas | 96.56 | |
3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 96.54 | |
1x6v_B | 630 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 96.54 | |
4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 96.54 | |
3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 96.54 | |
1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 96.52 | |
4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 96.52 | |
3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 96.52 | |
1e69_A | 322 | Chromosome segregation SMC protein; structural mai | 96.52 | |
1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.51 | |
2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.51 | |
3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 96.51 | |
3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 96.51 | |
1g8f_A | 511 | Sulfate adenylyltransferase; alpha-beta protein, b | 96.5 | |
3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 96.49 | |
2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 96.48 | |
3thx_A | 934 | DNA mismatch repair protein MSH2; ABC family ATPas | 96.47 | |
2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 96.46 | |
2axn_A | 520 | 6-phosphofructo-2-kinase/fructose-2,6- biphosphata | 96.45 | |
3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 96.45 | |
1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 96.43 | |
4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 96.41 | |
1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 96.4 | |
3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 96.39 | |
2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 96.39 | |
3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 96.38 | |
3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.38 | |
3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 96.37 | |
1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.37 | |
1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 96.37 | |
4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 96.36 | |
2qag_C | 418 | Septin-7; cell cycle, cell division, GTP-binding, | 96.35 | |
2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 96.35 | |
1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 96.35 | |
2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 96.35 | |
1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 96.34 | |
2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 96.33 | |
3clv_A | 208 | RAB5 protein, putative; malaria, GTPase, structura | 96.32 | |
3oes_A | 201 | GTPase rhebl1; small GTPase, structural genomics, | 96.31 | |
2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.29 | |
4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 96.28 | |
2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 96.28 | |
1ko7_A | 314 | HPR kinase/phosphatase; protein kinase, phosphotra | 96.28 | |
4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 96.27 | |
2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 96.27 | |
1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 96.25 | |
3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 96.22 | |
1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.2 | |
2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 96.2 | |
3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 96.19 | |
2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 96.18 | |
2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 96.18 | |
2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 96.17 | |
2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 96.11 | |
4ad8_A | 517 | DNA repair protein RECN; DNA binding protein, ATPa | 96.09 | |
1f6b_A | 198 | SAR1; gtpases, N-terminal helix, Mg-containing com | 96.06 | |
3lxx_A | 239 | GTPase IMAP family member 4; structural genomics c | 96.05 | |
2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 96.05 | |
2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 96.01 | |
1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 95.97 | |
1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 95.97 | |
1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 95.96 | |
1z0f_A | 179 | RAB14, member RAS oncogene family; RAB GTPase, ves | 95.96 | |
1udx_A | 416 | The GTP-binding protein OBG; TGS domain, riken str | 95.96 | |
1m8p_A | 573 | Sulfate adenylyltransferase; rossmann fold, phosph | 95.95 | |
3co5_A | 143 | Putative two-component system transcriptional RES | 95.95 | |
2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 95.94 | |
2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 95.94 | |
2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 95.93 | |
2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 95.91 | |
1ega_A | 301 | Protein (GTP-binding protein ERA); GTPase, RNA-bin | 95.91 | |
2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 95.91 | |
2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 95.9 | |
1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 95.88 | |
3ice_A | 422 | Transcription termination factor RHO; transcriptio | 95.88 | |
3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 95.87 | |
1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 95.87 | |
1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 95.86 | |
2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 95.85 | |
3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 95.85 | |
2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 95.83 | |
1bif_A | 469 | 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; | 95.83 | |
1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 95.82 | |
1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 95.81 | |
1kjw_A | 295 | Postsynaptic density protein 95; protein-protein i | 95.81 | |
2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 95.81 | |
3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 95.81 | |
3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 95.8 | |
1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 95.8 | |
1dek_A | 241 | Deoxynucleoside monophosphate kinase; transferase, | 95.8 | |
1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 95.79 | |
2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 95.78 | |
3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 95.77 | |
2gco_A | 201 | H9, RHO-related GTP-binding protein RHOC; GTPase,s | 95.75 | |
1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 95.75 | |
2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 95.74 | |
1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 95.74 | |
1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 95.73 | |
1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 95.73 | |
1fzq_A | 181 | ADP-ribosylation factor-like protein 3; protein-GD | 95.73 | |
1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 95.73 | |
1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 95.72 | |
2qgz_A | 308 | Helicase loader, putative primosome component; str | 95.72 | |
2hf9_A | 226 | Probable hydrogenase nickel incorporation protein | 95.71 | |
2gks_A | 546 | Bifunctional SAT/APS kinase; transferase, sulfuryl | 95.68 | |
2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 95.68 | |
3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 95.67 | |
3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 95.65 | |
2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 95.65 | |
2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.65 | |
2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.63 | |
1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 95.62 | |
1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 95.62 | |
1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 95.62 | |
3pqc_A | 195 | Probable GTP-binding protein ENGB; rossmann fold, | 95.61 | |
2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 95.61 | |
2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 95.61 | |
4dhe_A | 223 | Probable GTP-binding protein ENGB; melioidosis, RA | 95.61 | |
3kkq_A | 183 | RAS-related protein M-RAS; GTP-binding, GTPase, si | 95.59 | |
2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 95.58 | |
3k53_A | 271 | Ferrous iron transport protein B; GTPase fold, hel | 95.58 | |
2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 95.58 | |
1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 95.57 | |
3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 95.57 | |
3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 95.56 | |
3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 95.54 | |
3con_A | 190 | GTPase NRAS; structural genomics consortium, SGC, | 95.54 | |
3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 95.54 | |
3bwd_D | 182 | RAC-like GTP-binding protein ARAC6; G domain, cyto | 95.54 | |
1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 95.54 | |
3tw8_B | 181 | RAS-related protein RAB-35; longin domain, RAB GTP | 95.53 | |
2gf9_A | 189 | RAS-related protein RAB-3D; G-protein, structural | 95.53 | |
2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 95.52 | |
2fv8_A | 207 | H6, RHO-related GTP-binding protein RHOB; GDP/GTP | 95.52 | |
2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 95.51 | |
2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 95.5 | |
3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.5 | |
4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 95.49 | |
2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 95.47 | |
2bov_A | 206 | RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, | 95.47 | |
1z06_A | 189 | RAS-related protein RAB-33B; RAB GTPase, RAB33B GT | 95.47 | |
1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 95.44 | |
3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 95.42 | |
1moz_A | 183 | ARL1, ADP-ribosylation factor-like protein 1; GTP- | 95.39 | |
2atv_A | 196 | RERG, RAS-like estrogen-regulated growth inhibitor | 95.39 | |
2efe_B | 181 | Small GTP-binding protein-like; GEF, GTPase, VPS9, | 95.38 | |
2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 95.37 | |
4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 95.35 | |
1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 95.35 | |
1ksh_A | 186 | ARF-like protein 2; small GTPase, small GTP-bindin | 95.34 | |
2xtp_A | 260 | GTPase IMAP family member 2; immune system, G prot | 95.34 | |
1knx_A | 312 | Probable HPR(Ser) kinase/phosphatase; HPR kinase, | 95.34 | |
2qtf_A | 364 | Protein HFLX, GTP-binding protein; beta-alpha-barr | 95.33 | |
2g6b_A | 180 | RAS-related protein RAB-26; G-protein, GTP analogu | 95.31 | |
3lxw_A | 247 | GTPase IMAP family member 1; immunity, structural | 95.31 | |
2bme_A | 186 | RAB4A, RAS-related protein RAB4A; GTP-binding prot | 95.3 | |
2xxa_A | 433 | Signal recognition particle protein; protein trans | 95.3 | |
3t1o_A | 198 | Gliding protein MGLA; G domain containing protein, | 95.29 | |
2qu8_A | 228 | Putative nucleolar GTP-binding protein 1; GTPase, | 95.29 | |
3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.29 | |
2vf7_A | 842 | UVRA2, excinuclease ABC, subunit A.; DNA-binding p | 95.29 | |
2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 95.29 | |
3tvt_A | 292 | Disks large 1 tumor suppressor protein; DLG, SRC-h | 95.28 | |
2p5s_A | 199 | RAS and EF-hand domain containing; G-protein, RAB, | 95.27 | |
1vg8_A | 207 | RAS-related protein RAB-7; GTP-binding protein, pr | 95.25 | |
1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 95.24 | |
3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 95.23 | |
3tkl_A | 196 | RAS-related protein RAB-1A; vesicle trafficking, p | 95.23 | |
2e87_A | 357 | Hypothetical protein PH1320; GTP-binding, GTPase, | 95.22 | |
1mh1_A | 186 | RAC1; GTP-binding, GTPase, small G-protein, RHO fa | 95.2 | |
2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 95.19 | |
3iev_A | 308 | GTP-binding protein ERA; ERA, GTPase, KH domain, a | 95.19 | |
4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 95.18 | |
1mky_A | 439 | Probable GTP-binding protein ENGA; GTPase, DER, KH | 95.18 | |
2q3h_A | 201 | RAS homolog gene family, member U; GTPase, structu | 95.17 | |
2fh5_B | 214 | SR-beta, signal recognition particle receptor beta | 95.16 | |
2fg5_A | 192 | RAB-22B, RAS-related protein RAB-31; G-protein, GT | 95.14 | |
3t5g_A | 181 | GTP-binding protein RHEB; immunoglobulin-like beta | 95.14 | |
1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 95.13 | |
2a5j_A | 191 | RAS-related protein RAB-2B; GTPase, signal transdu | 95.12 | |
1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 95.1 | |
3cph_A | 213 | RAS-related protein SEC4; RAB GTPase, prenylation, | 95.08 | |
1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 95.07 | |
3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 95.06 | |
1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 95.04 | |
1p6x_A | 334 | Thymidine kinase; P-loop, LID, transferase; HET: T | 95.03 | |
1zd9_A | 188 | ADP-ribosylation factor-like 10B; transport protei | 95.02 | |
4bas_A | 199 | ADP-ribosylation factor, putative (small GTPase, p | 95.02 | |
1x3s_A | 195 | RAS-related protein RAB-18; GTPase, GNP, structura | 95.02 | |
3t34_A | 360 | Dynamin-related protein 1A, linker, dynamin-relat | 95.01 | |
2h17_A | 181 | ADP-ribosylation factor-like protein 5A; GDP, GTPa | 95.0 | |
2bcg_Y | 206 | Protein YP2, GTP-binding protein YPT1; RABGTPase, | 94.98 | |
2cjw_A | 192 | GTP-binding protein GEM; nucleotide-binding, small | 94.98 | |
3dz8_A | 191 | RAS-related protein RAB-3B; GDP, GTPase, structura | 94.96 | |
2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 94.94 | |
1zbd_A | 203 | Rabphilin-3A; G protein, effector, RABCDR, synapti | 94.93 | |
3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 94.92 | |
1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 94.91 | |
3reg_A | 194 | RHO-like small GTPase; cytoskeleton, nucleotide-bi | 94.9 | |
3tsz_A | 391 | Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol | 94.9 | |
3b1v_A | 272 | Ferrous iron uptake transporter protein B; G prote | 94.87 | |
2il1_A | 192 | RAB12; G-protein, GDP, GTPase, predicted, structur | 94.87 | |
2ew1_A | 201 | RAS-related protein RAB-30; G-protein, GTP analogu | 94.85 | |
3c5c_A | 187 | RAS-like protein 12; GDP, GTPase, structural genom | 94.84 | |
2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 94.83 | |
3cbq_A | 195 | GTP-binding protein REM 2; FLJ38964A, structural g | 94.8 | |
3ch4_B | 202 | Pmkase, phosphomevalonate kinase; parallel beta-sh | 94.79 | |
3pih_A | 916 | Uvrabc system protein A; hydrolase, ABC ATPase, DN | 94.78 | |
2b6h_A | 192 | ADP-ribosylation factor 5; membrane trafficking, G | 94.76 | |
2o52_A | 200 | RAS-related protein RAB-4B; G-protein, GDP, struct | 94.75 | |
3shw_A | 468 | Tight junction protein ZO-1; PDZ-SH3-GUK supramodu | 94.73 | |
2qag_A | 361 | Septin-2, protein NEDD5; cell cycle, cell division | 94.72 | |
2ygr_A | 993 | Uvrabc system protein A; hydrolase, nucleotide exc | 94.72 | |
3cpj_B | 223 | GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl | 94.71 | |
3iby_A | 256 | Ferrous iron transport protein B; G protein, G dom | 94.71 | |
2h57_A | 190 | ADP-ribosylation factor-like protein 6; GTP, GTPas | 94.7 | |
2dy1_A | 665 | Elongation factor G; translocation, GTP complex, s | 94.68 | |
2r6f_A | 972 | Excinuclease ABC subunit A; UVRA, nucleotide excis | 94.68 | |
3th5_A | 204 | RAS-related C3 botulinum toxin substrate 1; rossma | 93.7 | |
2fu5_C | 183 | RAS-related protein RAB-8A; MSS4:RAB8 protein comp | 94.67 | |
2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 94.67 | |
3a1s_A | 258 | Iron(II) transport protein B; FEOB, iron transport | 94.67 |
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
---|
Probab=100.00 E-value=4.6e-70 Score=504.23 Aligned_cols=253 Identities=40% Similarity=0.717 Sum_probs=240.4 Q ss_pred CCeEEEEECCCchhHHHHHHHHHhhCCCeEeecCCceEeccccCCCCCCCHHHHcccccccccccCcCccchHHHHHHHH Q psy8556 36 RKTKVAILGPTASGKSSVALKISEYIPCEIISIDSALVYCDMDIGTNKPSIIEREITPHHLIDIIEPTKSYSVIQFCEDA 115 (298) Q Consensus 36 kg~iI~I~GpTGSGKSTLa~~La~~l~~~iis~Ds~qvy~g~~i~t~kp~~~e~~~v~~~l~~~~~~~e~~s~~~f~~~~ 115 (298) .+.+|+|+||||||||||+..||+.+++++||+||+|||++++|+|++|++.|+.+++|||++..++.+.|++++|.+.+ T Consensus 9 ~~~~i~i~GptgsGKt~la~~La~~~~~~iis~Ds~qvY~~~~igTakp~~~E~~~v~hhlid~~~~~e~~s~~~f~~~a 88 (316) T 3foz_A 9 LPKAIFLMGPTASGKTALAIELRKILPVELISVDSALIYKGMDIGTAKPNAEELLAAPHRLLDIRDPSQAYSAADFRRDA 88 (316) T ss_dssp CCEEEEEECCTTSCHHHHHHHHHHHSCEEEEECCTTTTBTTCCTTTTCCCHHHHHHSCEETSSCBCTTSCCCHHHHHHHH T ss_pred CCcEEEEECCCccCHHHHHHHHHHhCCCcEEecccccccccccccCCCCCHHHHcCCCEEEeccCCccccccHHHHHHHH Confidence 46789999999999999999999999999999999999999999999999999999999999999999999999999999 Q ss_pred HHhhHHHhhcCCceEEEchhHHHHHHHHccCCCCCCCCHHHHHHHHHHHHhhCHHHHHHHHhcCCccccC---------- Q psy8556 116 LFSIKNILKKKKLPLLVGGTMLYFKALRDGINKLPPANLKLRTKFNIDINKYGISFLYDKLKLLDPVTAN---------- 185 (298) Q Consensus 116 ~~~i~~i~~~~~~~IlvGGt~~y~~~ll~~~~~~p~~d~~lr~~l~~~~~~~g~~~l~~~L~~~Dp~~a~---------- 185 (298) .+.+.++..+|++||+||||++|++++++|+.++|+.|+++|.+++..+.+.|+..||+.|+++||++|+ T Consensus 89 ~~~i~~i~~~g~~pilVGGTglYi~all~gl~~~p~~~~~~R~~l~~~~~~~g~~~l~~~L~~~DP~~A~ri~pnd~~Ri 168 (316) T 3foz_A 89 LAEMADITAAGRIPLLVGGTMLYFKALLEGLSPLPSADPEVRARIEQQAAEQGWESLHRQLQEVDPVAAARIHPNDPQRL 168 (316) T ss_dssp HHHHHHHHHTTCEEEEEESCHHHHHHHHSCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHSCTTCHHHH T ss_pred HHHHHHHHhCCCcEEEEcCcHHHHHHHHcCcCCCCCCCHHHHHHHHHHHHhcCHHHHHHHHHHhCHHHHhhCCCccHHHH Confidence 9999999999999999999999999999999999999999999999999999999999999999999887 Q ss_pred ---------------------------------CCC-ChHHHHHHHHHHHHHHHhccchHHHHHHHHHhcCCCCCCCccc Q psy8556 186 ---------------------------------QPS-NRHILHKRISDRFKKMLDQDLLINEVKKIRKKWNLNLNLPSMK 231 (298) Q Consensus 186 ---------------------------------~~~-~r~~L~~ri~~Rv~~M~~~G~l~~Ev~~l~~~~~~~~~~~~~~ 231 (298) +.+ ||++||+||++||+.|+++| |++||+.|++.+.+..+.++++ T Consensus 169 ~RALEV~~~TG~~~S~~~~~~~~~~~~~~~~i~L~~~~R~~L~~RI~~Rvd~Ml~~G-l~eEv~~L~~~~~~~~~~~~~~ 247 (316) T 3foz_A 169 SRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRFHQMLASG-FEAEVRALFARGDLHTDLPSIR 247 (316) T ss_dssp HHHHHHHHHHSSCHHHHHTSCCCCCSSEEEEEEEECSSHHHHHHHHHHHHHHHHHTT-HHHHHHHHHHHSCCCTTSTTTT T ss_pred HHHHHHHHHHCCCHHHHhhccCCCCCCceEEEEecCCCHHHHHHHHHHHHHHHHHCC-HHHHHHHHHHccCCCccCccce Confidence 224 89999999999999999999 9999999999844678899999 Q ss_pred ccChhhHHHHHcCCCCHHHHHHHHHHHHHHHHhHHHHHhcCCCCceeecCCCchHHHH Q psy8556 232 CIGYRQTWEYIDGLIDRNTLKEKSIIATRQLAKQQLTWLRNMNEKITIDCLEKNCVQK 289 (298) Q Consensus 232 ~IGyke~~~~l~g~~~~~~~~~~~~~~tr~yakrQ~twfr~~~~~~~~~~~~~~~~~~ 289 (298) +|||||+++||+|+++++++++.++.+||||||||+||||++++++|+|.++.+.+.. T Consensus 248 aIGYkE~~~yL~G~~s~~eai~~~~~~TR~yAKRQ~TWfR~~~~~~w~~~~~~~~~~~ 305 (316) T 3foz_A 248 CVGYRQMWSYLEGEISYDEMVYRGVCATRQLAKRQITWLRGWEGVHWLDSEKPEQARD 305 (316) T ss_dssp STTHHHHHHHHHTSSCHHHHHHHHHHHHHHHHHHHHHHHHSCSSCEEEETTCHHHHHH T ss_pred eeehhhHHHHhcCCCCHHHHHHHHHHHHHHHHHHHHHHhCCCCCCeEeCCcChHHHHH Confidence 9999999999999999999999999999999999999999999999999877554433 |
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
---|
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
---|
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
---|
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
---|
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
---|
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
---|
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
---|
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
---|
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
---|
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
---|
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
---|
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
---|
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
---|
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
---|
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
---|
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
---|
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
---|
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
---|
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
---|
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
---|
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
---|
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
---|
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
---|
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
---|
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
---|
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
---|
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
---|
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
---|
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
---|
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
---|
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
---|
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
---|
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
---|
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
---|
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
---|
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
---|
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
---|
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
---|
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} | Back alignment and structure |
---|
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
---|
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
---|
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
---|
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
---|
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A | Back alignment and structure |
---|
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
---|
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
---|
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
---|
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
---|
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
---|
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
---|
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
---|
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
---|
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
---|
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
---|
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
---|
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
---|
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
---|
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
---|
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
---|
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
---|
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
---|
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
---|
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
---|
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
---|
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
---|
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A | Back alignment and structure |
---|
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
---|
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
---|
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} | Back alignment and structure |
---|
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
---|
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
---|
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
---|
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
---|
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
---|
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
---|
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
---|
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
---|
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
---|
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
---|
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} | Back alignment and structure |
---|
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
---|
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
---|
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
---|
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* | Back alignment and structure |
---|
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
---|
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
---|
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
---|
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
---|
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
---|
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
---|
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
---|
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 | Back alignment and structure |
---|
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
---|
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
---|
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
---|
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* | Back alignment and structure |
---|
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
---|
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
---|
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
---|
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
---|
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
---|
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
---|
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
---|
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
---|
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
---|
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
---|
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
---|
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
---|
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
---|
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
---|
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
---|
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} | Back alignment and structure |
---|
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
---|
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
---|
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
---|
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
---|
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* | Back alignment and structure |
---|
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
---|
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
---|
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
---|
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
---|
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
---|
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
---|
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} | Back alignment and structure |
---|
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* | Back alignment and structure |
---|
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
---|
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
---|
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
---|
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
---|
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
---|
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
---|
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
---|
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
---|
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
---|
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
---|
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
---|
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
---|
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
---|
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
---|
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
---|
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
---|
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
---|
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
---|
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
---|
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* | Back alignment and structure |
---|
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
---|
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
---|
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
---|
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* | Back alignment and structure |
---|
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
---|
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
---|
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
---|
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
---|
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
---|
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
---|
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
---|
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
---|
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
---|
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
---|
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
---|
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 | Back alignment and structure |
---|
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
---|
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
---|
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
---|
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
---|
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
---|
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
---|
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
---|
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
---|
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
---|
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
---|
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B | Back alignment and structure |
---|
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
---|
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
---|
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
---|
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
---|
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
---|
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
---|
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
---|
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} | Back alignment and structure |
---|
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
---|
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
---|
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
---|
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
---|
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
---|
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
---|
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
---|
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
---|
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
---|
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
---|
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
---|
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
---|
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
---|
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
---|
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
---|
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
---|
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
---|
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
---|
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
---|
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
---|
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
---|
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
---|
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
---|
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
---|
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
---|
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
---|
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
---|
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
---|
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
---|
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A | Back alignment and structure |
---|
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
---|
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
---|
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
---|
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
---|
>3hdt_A Putative kinase; structura genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; 2.79A {Clostridium symbiosum atcc 14940} | Back alignment and structure |
---|
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
---|
>3fdi_A Uncharacterized protein; cytidylate kinase like protein, PSI, MCSG, PRK04182 class ME structural genomics, protein structure initiative; 2.20A {Eubacterium ventriosum} | Back alignment and structure |
---|
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} | Back alignment and structure |
---|
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
---|
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
---|
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
---|
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
---|
>1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
---|
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
---|
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
---|
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
---|
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
---|
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
---|
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
---|
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
---|
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* | Back alignment and structure |
---|
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* | Back alignment and structure |
---|
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
---|
>4i1u_A Dephospho-COA kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.05A {Burkholderia vietnamiensis} PDB: 4i1v_A* | Back alignment and structure |
---|
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
---|
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
---|
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
---|
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
---|
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
---|
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
---|
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
---|
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
---|
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
---|
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
---|
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} | Back alignment and structure |
---|
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B | Back alignment and structure |
---|
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 | Back alignment and structure |
---|
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
---|
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* | Back alignment and structure |
---|
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
---|
>3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
---|
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
---|
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 | Back alignment and structure |
---|
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
---|
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
---|
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* | Back alignment and structure |
---|
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
---|
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
---|
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* | Back alignment and structure |
---|
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
---|
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
---|
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
---|
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
---|
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
---|
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
---|
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
---|
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
---|
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
---|
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
---|
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} | Back alignment and structure |
---|
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
---|
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* | Back alignment and structure |
---|
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
---|
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
---|
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
---|
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
---|
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
---|
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
---|
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
---|
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* | Back alignment and structure |
---|
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
---|
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
---|
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* | Back alignment and structure |
---|
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
---|
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* | Back alignment and structure |
---|
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
---|
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
---|
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
---|
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
---|
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
---|
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
---|
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
---|
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
---|
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
---|
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
---|
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
---|
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
---|
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
---|
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
---|
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
---|
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
---|
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
---|
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} | Back alignment and structure |
---|
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
---|
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
---|
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
---|
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
---|
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
---|
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
---|
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
---|
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
---|
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
---|
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
---|
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
---|
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
---|
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
---|
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} | Back alignment and structure |
---|
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* | Back alignment and structure |
---|
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
---|
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
---|
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
---|
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
---|
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
---|
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
---|
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* | Back alignment and structure |
---|
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 | Back alignment and structure |
---|
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* | Back alignment and structure |
---|
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
---|
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
---|
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
---|
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
---|
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
---|
>1ega_A Protein (GTP-binding protein ERA); GTPase, RNA-binding, RAS-like, hydrolase; 2.40A {Escherichia coli} SCOP: c.37.1.8 d.52.3.1 PDB: 1x1l_X 3ieu_A* 1x18_X | Back alignment and structure |
---|
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
---|
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
---|
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
---|
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
---|
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
---|
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
---|
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
---|
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
---|
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
---|
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
---|
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A | Back alignment and structure |
---|
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
---|
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
---|
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A | Back alignment and structure |
---|
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
---|
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
---|
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
---|
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
---|
>1dek_A Deoxynucleoside monophosphate kinase; transferase, phosphotransferase; HET: DGP; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 PDB: 1del_A* | Back alignment and structure |
---|
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
---|
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
---|
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... | Back alignment and structure |
---|
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
---|
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
---|
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
---|
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
---|
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* | Back alignment and structure |
---|
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
---|
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
---|
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
---|
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* | Back alignment and structure |
---|
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} | Back alignment and structure |
---|
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A | Back alignment and structure |
---|
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
---|
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
---|
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* | Back alignment and structure |
---|
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
---|
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
---|
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
---|
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
---|
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
---|
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A | Back alignment and structure |
---|
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
---|
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
---|
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} | Back alignment and structure |
---|
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* | Back alignment and structure |
---|
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
---|
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} | Back alignment and structure |
---|
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
---|
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
---|
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
---|
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
---|
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
---|
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* | Back alignment and structure |
---|
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
---|
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C | Back alignment and structure |
---|
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
---|
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} | Back alignment and structure |
---|
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* | Back alignment and structure |
---|
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
---|
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
---|
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
---|
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
---|
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
---|
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
---|
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
---|
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} | Back alignment and structure |
---|
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* | Back alignment and structure |
---|
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
---|
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
---|
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
---|
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
---|
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* | Back alignment and structure |
---|
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
---|
>4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
---|
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
---|
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* | Back alignment and structure |
---|
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A | Back alignment and structure |
---|
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 | Back alignment and structure |
---|
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A | Back alignment and structure |
---|
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
---|
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* | Back alignment and structure |
---|
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 | Back alignment and structure |
---|
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* | Back alignment and structure |
---|
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} | Back alignment and structure |
---|
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* | Back alignment and structure |
---|
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
---|
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* | Back alignment and structure |
---|
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} | Back alignment and structure |
---|
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* | Back alignment and structure |
---|
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
---|
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
---|
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} | Back alignment and structure |
---|
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} | Back alignment and structure |
---|
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... | Back alignment and structure |
---|
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
---|
>3iev_A GTP-binding protein ERA; ERA, GTPase, KH domain, anti-SD, 16S rRNA, 30S ribosome ASSE GTP-binding, nucleotide-binding; HET: GNP; 1.90A {Aquifex aeolicus} PDB: 3r9w_A* 3r9x_A* | Back alignment and structure |
---|
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
---|
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 | Back alignment and structure |
---|
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} | Back alignment and structure |
---|
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 | Back alignment and structure |
---|
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
---|
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* | Back alignment and structure |
---|
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
---|
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* | Back alignment and structure |
---|
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
---|
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
---|
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
---|
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
---|
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
---|
>1p6x_A Thymidine kinase; P-loop, LID, transferase; HET: THM; 2.00A {Equid herpesvirus 4} SCOP: c.37.1.1 PDB: 1p72_A* 1p73_A* 1p75_A* | Back alignment and structure |
---|
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* | Back alignment and structure |
---|
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} | Back alignment and structure |
---|
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
---|
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* | Back alignment and structure |
---|
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* | Back alignment and structure |
---|
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* | Back alignment and structure |
---|
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* | Back alignment and structure |
---|
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
---|
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
---|
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 | Back alignment and structure |
---|
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
---|
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
---|
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* | Back alignment and structure |
---|
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A | Back alignment and structure |
---|
>3b1v_A Ferrous iron uptake transporter protein B; G protein, iron transport, GTPase, transmembrane, potassium; HET: GGM; 1.85A {Streptococcus thermophilus} PDB: 3b1w_A* 3lx5_A* 3lx8_A* 3ss8_A* 3b1z_A 3b1y_A* 3b1x_A* 3tah_A* | Back alignment and structure |
---|
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} | Back alignment and structure |
---|
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
---|
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} | Back alignment and structure |
---|
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
---|
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} | Back alignment and structure |
---|
>3ch4_B Pmkase, phosphomevalonate kinase; parallel beta-sheet with the strand order 23145, walker A motif, cholesterol biosynthesis, lipid synthesis; 1.76A {Homo sapiens} | Back alignment and structure |
---|
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} | Back alignment and structure |
---|
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* | Back alignment and structure |
---|
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} | Back alignment and structure |
---|
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} | Back alignment and structure |
---|
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
---|
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} | Back alignment and structure |
---|
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} | Back alignment and structure |
---|
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} | Back alignment and structure |
---|
>2dy1_A Elongation factor G; translocation, GTP complex, structural genomics, NPPSFA; HET: GTP; 1.60A {Thermus thermophilus} SCOP: b.43.3.1 c.37.1.8 d.14.1.1 d.58.11.1 d.58.11.1 PDB: 1wdt_A* | Back alignment and structure |
---|
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A | Back alignment and structure |
---|
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} | Back alignment and structure |
---|
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* | Back alignment and structure |
---|
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
---|
>3a1s_A Iron(II) transport protein B; FEOB, iron transporter, small GTPase, G protein, GDI; HET: GDP; 1.50A {Thermotoga maritima} PDB: 3a1t_A* 3a1u_A* 3a1v_A* 3a1w_A | Back alignment and structure |
---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
ID | Alignment Graph | Length | Definition | Probability |
Query | 298 | |||
d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 99.19 | |
d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 99.13 | |
d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 99.12 | |
d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 99.07 | |
d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 99.05 | |
d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 99.03 | |
d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 99.01 | |
d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 98.99 | |
d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 98.96 | |
d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 98.95 | |
d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 98.93 | |
d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 98.87 | |
d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 98.83 | |
d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 98.77 | |
d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 98.68 | |
d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 98.66 | |
d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 98.65 | |
d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 98.64 | |
d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 98.59 | |
d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 98.58 | |
d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 98.58 | |
d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 98.51 | |
d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 98.48 | |
d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 98.48 | |
d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 98.48 | |
d1a7ja_ | 288 | Phosphoribulokinase {Rhodobacter sphaeroides [TaxI | 98.43 | |
d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 98.42 | |
d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 98.39 | |
d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 98.31 | |
d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 98.28 | |
d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 98.26 | |
d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 98.23 | |
d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 98.23 | |
d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 98.19 | |
d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 98.19 | |
d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 98.16 | |
d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 98.12 | |
d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 98.1 | |
d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 98.1 | |
d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 98.07 | |
d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 98.04 | |
d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 98.03 | |
d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 98.02 | |
d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 98.02 | |
d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 98.0 | |
d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 97.98 | |
d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 97.96 | |
d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.94 | |
d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 97.93 | |
d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 97.93 | |
d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 97.93 | |
d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 97.92 | |
d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 97.88 | |
d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 97.81 | |
d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 97.79 | |
d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.79 | |
d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 97.79 | |
d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 97.78 | |
d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.75 | |
d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 97.72 | |
d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 97.71 | |
d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 97.7 | |
d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 97.67 | |
d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 97.66 | |
d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 97.64 | |
d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 97.63 | |
d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 97.62 | |
d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.61 | |
d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 97.6 | |
d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 97.6 | |
d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.6 | |
d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 97.58 | |
d1jjva_ | 205 | Dephospho-CoA kinase {Haemophilus influenzae [TaxI | 97.54 | |
d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 97.53 | |
d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.51 | |
d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 97.47 | |
d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 97.45 | |
d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 97.43 | |
d1vhta_ | 208 | Dephospho-CoA kinase {Escherichia coli [TaxId: 562 | 97.41 | |
d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 97.37 | |
d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.31 | |
d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 97.27 | |
d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.23 | |
d1deka_ | 241 | Deoxynucleoside monophosphate kinase {Bacteriophag | 97.22 | |
d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.22 | |
d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 97.18 | |
g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 97.15 | |
d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.07 | |
d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 97.07 | |
d1p5zb_ | 241 | Deoxycytidine kinase {Human (Homo sapiens) [TaxId: | 97.07 | |
d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 97.06 | |
d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.05 | |
d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 97.0 | |
d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.97 | |
g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 96.88 | |
d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 96.87 | |
d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 96.86 | |
d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 96.83 | |
d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 96.82 | |
d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 96.81 | |
d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 96.79 | |
d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.77 | |
d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 96.76 | |
d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.72 | |
d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 96.7 | |
d2ocpa1 | 241 | Deoxyguanosine kinase {Human (Homo sapiens) [TaxId | 96.68 | |
d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 96.66 | |
d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.66 | |
d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 96.6 | |
d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 96.59 | |
d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 96.49 | |
d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.49 | |
d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 96.44 | |
d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 96.43 | |
d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 96.39 | |
g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 96.38 | |
d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 96.36 | |
d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 96.35 | |
d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 96.35 | |
d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 96.34 | |
d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 96.31 | |
d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 96.31 | |
d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.29 | |
d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 96.29 | |
d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 96.29 | |
d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 96.29 | |
d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 96.28 | |
d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 96.25 | |
d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 96.25 | |
d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 96.23 | |
d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 96.2 | |
d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 96.2 | |
d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 96.17 | |
d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 96.16 | |
d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.16 | |
d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 96.14 | |
d1w1wa_ | 427 | Smc head domain {Baker's yeast (Saccharomyces cere | 96.11 | |
d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 96.07 | |
d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 96.04 | |
d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 96.03 | |
d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 96.01 | |
d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 95.99 | |
d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 95.99 | |
d1udxa2 | 180 | Obg GTP-binding protein middle domain {Thermus the | 95.94 | |
d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 95.93 | |
d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 95.92 | |
d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 95.9 | |
d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.89 | |
d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 95.86 | |
d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.85 | |
d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 95.75 | |
d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 95.64 | |
d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 95.63 | |
d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 95.63 | |
d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 95.58 | |
d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 95.55 | |
d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 95.5 | |
d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 95.48 | |
d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 95.48 | |
d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 95.38 | |
d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 95.35 | |
d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 95.34 | |
d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 95.33 | |
d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 95.26 | |
d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 95.2 | |
d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 95.2 | |
d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 95.19 | |
d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 95.19 | |
d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 95.18 | |
d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 95.14 | |
d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 95.13 | |
d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 95.09 | |
d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 95.08 | |
d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.04 | |
d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 95.02 | |
d2a5yb3 | 277 | CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI | 95.02 | |
d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 94.96 | |
d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 94.93 | |
d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 94.9 | |
d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 94.88 | |
d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 94.88 | |
d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 94.87 | |
d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 94.85 | |
d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 94.85 | |
d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 94.8 | |
d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 94.79 | |
d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 94.77 | |
d1wb1a4 | 179 | Elongation factor SelB, N-terminal domain {Methano | 94.71 | |
d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 94.71 | |
d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 94.68 | |
d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 94.68 | |
d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 94.67 | |
d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 94.66 | |
d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 94.64 | |
d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 94.57 | |
d1g7sa4 | 227 | Initiation factor IF2/eIF5b, N-terminal (G) domain | 94.57 | |
d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 94.56 | |
d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 94.49 | |
d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 94.45 | |
d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 94.44 | |
d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 94.42 | |
d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 94.37 | |
d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 94.33 | |
d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 94.32 | |
d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 94.27 | |
d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 94.26 | |
d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 94.23 | |
d1zcba2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 94.22 | |
d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 94.19 | |
d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 94.16 | |
d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 94.11 | |
d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 94.04 | |
d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 94.04 | |
d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 94.03 | |
d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 94.01 | |
d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 93.96 | |
d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 93.9 | |
d1azta2 | 221 | Transducin (alpha subunit) {Cow (Bos taurus) [TaxI | 93.77 | |
d2bmja1 | 175 | Centaurin gamma 1, G domain {Human (Homo sapiens) | 93.76 | |
d1f5na2 | 277 | Interferon-induced guanylate-binding protein 1 (GB | 93.68 | |
d1kjwa2 | 199 | Guanylate kinase-like domain of Psd-95 {Rat (Rattu | 93.43 | |
d1g8fa3 | 122 | ATP sulfurylase C-terminal domain {Baker's yeast ( | 93.39 | |
d1tq4a_ | 400 | Interferon-inducible GTPase {Mouse (Mus musculus) | 93.39 | |
d2bcjq2 | 200 | Transducin (alpha subunit) {Mouse (Mus musculus) [ | 93.34 | |
d1svsa1 | 195 | Transducin (alpha subunit) {Rat (Rattus norvegicus | 93.07 | |
d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 92.65 | |
d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 92.62 | |
d1xpua3 | 289 | Transcription termination factor Rho, ATPase domai | 92.57 | |
d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 92.56 | |
d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 92.09 | |
d1p6xa_ | 333 | Thymidine kinase {Equine herpesvirus type 4 [TaxId | 92.07 | |
d2c78a3 | 204 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 91.99 | |
d1e2ka_ | 329 | Thymidine kinase {Herpes simplex virus type 1, dif | 91.91 | |
d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 91.83 | |
d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 91.8 | |
d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 91.7 | |
d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 91.38 | |
d1osna_ | 331 | Thymidine kinase {Varicella-zoster virus [TaxId: 1 | 91.29 | |
d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 91.03 | |
d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 90.98 | |
d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 90.86 | |
d1cp2a_ | 269 | Nitrogenase iron protein {Clostridium pasteurianum | 90.66 | |
d2akab1 | 299 | Dynamin G domain {Rat (Rattus norvegicus) [TaxId: | 90.63 | |
d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 90.53 | |
d2olra1 | 313 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 90.38 | |
d1jwyb_ | 306 | Dynamin G domain {Dictyostelium discoideum [TaxId: | 90.37 | |
d1ihua2 | 279 | Arsenite-translocating ATPase ArsA {Escherichia co | 90.27 | |
d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 90.19 | |
d2qn6a3 | 205 | Initiation factor eIF2 gamma subunit, N-terminal ( | 89.81 | |
d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 89.69 | |
d2bv3a2 | 276 | Elongation factor G (EF-G), N-terminal (G) domain | 89.64 | |
d1g3qa_ | 237 | Cell division regulator MinD {Archaeon Pyrococcus | 89.55 | |
d2jdid3 | 276 | Central domain of beta subunit of F1 ATP synthase | 89.44 | |
d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 89.12 | |
d1ii2a1 | 323 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 88.98 | |
d2dy1a2 | 267 | Elongation factor G (EF-G), N-terminal (G) domain | 88.79 | |
d1j3ba1 | 318 | Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxalo | 88.45 | |
d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 88.31 | |
d1d2ea3 | 196 | Elongation factor Tu (EF-Tu), N-terminal (G) domai | 88.17 | |
d1kk1a3 | 195 | Initiation factor eIF2 gamma subunit, N-terminal ( | 87.97 | |
d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 87.56 | |
d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 87.55 | |
d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 87.36 | |
d1jnya3 | 224 | Elongation factor eEF-1alpha, N-terminal (G) domai | 86.67 | |
d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 86.61 | |
d1ni3a1 | 296 | YchF GTP-binding protein N-terminal domain {Fissio | 86.5 | |
d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 86.32 | |
d1wxqa1 | 319 | GTP-binding protein PH0525 {Pyrococcus horikoshii | 86.16 | |
d1hyqa_ | 232 | Cell division regulator MinD {Archaeon Archaeoglob | 85.77 | |
d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 85.63 | |
d2afhe1 | 289 | Nitrogenase iron protein {Azotobacter vinelandii [ | 84.59 | |
d1jala1 | 278 | YchF GTP-binding protein N-terminal domain {Haemop | 84.09 | |
d1puja_ | 273 | Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 | 82.17 | |
d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 82.07 | |
d1r5ba3 | 245 | Eukaryotic peptide chain release factor ERF2, G do | 81.97 | |
d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 81.96 | |
d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 81.47 | |
d2jdia3 | 285 | Central domain of alpha subunit of F1 ATP synthase | 80.7 | |
d1r0ka2 | 150 | 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z | 80.7 | |
d1zunb3 | 222 | Sulfate adenylate transferase subunit cysN/C, EF-T | 80.56 | |
d1gg4a4 | 214 | UDP-murNac-tripeptide D-alanyl-D-alanine-adding en | 80.27 |
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: ABC transporter ATPase domain-like domain: Maltose transport protein MalK, N-terminal domain species: Escherichia coli [TaxId: 562] Probab=99.19 E-value=1.2e-11 Score=107.70 Aligned_cols=144 Identities=17% Similarity=0.164 Sum_probs=75.7 Q ss_pred hcccCchhhhhhccccccccccccCCCeEEEEECCCchhHHHHHHHHHhhCCCeEeecCCceE-eccccCCCCCCCHHHH Q psy8556 11 DTETDPQQRQLTADFRRIRTGKLLFRKTKVAILGPTASGKSSVALKISEYIPCEIISIDSALV-YCDMDIGTNKPSIIER 89 (298) Q Consensus 11 ~~~~~~~~~~~~~~~~~~~~~~~~~kg~iI~I~GpTGSGKSTLa~~La~~l~~~iis~Ds~qv-y~g~~i~t~kp~~~e~ 89 (298) .++.|++ ...++++++ .-++|++++|+||||||||||+++|++.+. +++|+| +.|.++...++....+ T Consensus 6 v~k~yg~-~~~l~~isl-----~i~~Gei~~liGpsGsGKSTLl~~i~Gl~~-----p~sG~I~i~g~~i~~~~~~~r~i 74 (232) T d2awna2 6 VTKAWGE-VVVSKDINL-----DIHEGEFVVFVGPSGCGKSTLLRMIAGLET-----ITSGDLFIGEKRMNDTPPAERGV 74 (232) T ss_dssp EEEEETT-EEEEEEEEE-----EECTTCEEEEECCTTSSHHHHHHHHHTSSC-----CSEEEEEESSSCCTTSCGGGTCE T ss_pred EEEEECC-EEEEeeeEE-----EEcCCCEEEEECCCCChHHHHHHHHhcCCC-----CCCCEEEECCEECCCCchhhcee Confidence 5677853 345556665 225677999999999999999999999877 899999 6898887555544334 Q ss_pred cccccc--cccccCcCccchHHHHHH-----HHHHhhHHHhh--------cCCceEEEchhH---HHHHHHHcc----CC Q psy8556 90 EITPHH--LIDIIEPTKSYSVIQFCE-----DALFSIKNILK--------KKKLPLLVGGTM---LYFKALRDG----IN 147 (298) Q Consensus 90 ~~v~~~--l~~~~~~~e~~s~~~f~~-----~~~~~i~~i~~--------~~~~~IlvGGt~---~y~~~ll~~----~~ 147 (298) ..+++. ++..++..+++....... ...+.+.++++ ...+--++||.. ...++++.+ +. T Consensus 75 g~v~Q~~~l~~~~tv~eni~~~~~~~~~~~~~~~~~v~~~l~~~~l~~~~~~~~~~LSGGqkQRvaiAraL~~~P~illl 154 (232) T d2awna2 75 GMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLL 154 (232) T ss_dssp EEECSSCCC---------------------CHHHHHHHHHHHHC---------------------CHHHHHHTCCSEEEE T ss_pred eeeccccccccchhHHHHHHHHHHHcCCCHHHHHHHHHHHHHhCCChhhhhCChhhCCHHHHHHHHHHHHHhcCCCEEEE Confidence 445543 222233344433221111 11111222221 112235789877 577888876 44 Q ss_pred CCCCC--CHHHHHHHHHHHH Q psy8556 148 KLPPA--NLKLRTKFNIDIN 165 (298) Q Consensus 148 ~~p~~--d~~lr~~l~~~~~ 165 (298) |.|.+ |+..+..+.+.+. T Consensus 155 DEPts~LD~~~~~~i~~~l~ 174 (232) T d2awna2 155 DEPLSNLDAALRVQMRIEIS 174 (232) T ss_dssp ESTTTTSCHHHHHHHHHHHH T ss_pred cCCCCCCCHHHHHHHHHHHH Confidence 66754 7877776655443 |
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
---|
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
---|
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
---|
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
---|
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
---|
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
---|
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
---|
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
---|
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
---|
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
---|
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
---|
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
---|
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
---|
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
---|
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
---|
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
---|
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
---|
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
---|
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
---|
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
---|
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
---|
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
---|
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
---|
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
---|
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
---|
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
---|
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
---|
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
---|
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
---|
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
---|
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
---|
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
---|
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
---|
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
---|
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
---|
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
---|
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
---|
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
---|
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
---|
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
---|
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
---|
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
---|
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
---|
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
---|
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
---|
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
---|
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
---|
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
---|
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
---|
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
---|
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
---|
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
---|
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
---|
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
---|
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
---|
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
---|
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
---|
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
---|
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
---|
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
---|
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
---|
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
---|
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
---|
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
---|
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
---|
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
---|
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
---|
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
---|
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
---|
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
---|
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
---|
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
---|
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
---|
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
---|
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
---|
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
---|
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
---|
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
---|
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
---|
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
---|
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
---|
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
---|
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
---|
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
---|
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
---|
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
---|
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
---|
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
---|
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
---|
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
---|
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
---|
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
---|
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
---|
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
---|
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
---|
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
---|
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
---|
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
---|
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d1wb1a4 c.37.1.8 (A:1-179) Elongation factor SelB, N-terminal domain {Methanococcus maripaludis [TaxId: 39152]} | Back information, alignment and structure |
---|
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
---|
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1g7sa4 c.37.1.8 (A:1-227) Initiation factor IF2/eIF5b, N-terminal (G) domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
---|
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
---|
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
---|
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
---|
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
---|
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
---|
>d1g8fa3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
---|
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
---|
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
---|
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
---|
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
---|
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
---|
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} | Back information, alignment and structure |
---|
>d2c78a3 c.37.1.8 (A:9-212) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} | Back information, alignment and structure |
---|
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
---|
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
---|
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
---|
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} | Back information, alignment and structure |
---|
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
---|
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
---|
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
---|
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
---|
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
---|
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
---|
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
---|
>d2qn6a3 c.37.1.8 (A:2-206) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
---|
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
---|
>d2bv3a2 c.37.1.8 (A:7-282) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d1g3qa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
---|
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
---|
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
---|
>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
---|
>d2dy1a2 c.37.1.8 (A:8-274) Elongation factor G (EF-G), N-terminal (G) domain {Thermus thermophilus, EF-G-2 [TaxId: 274]} | Back information, alignment and structure |
---|
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
---|
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
---|
>d1d2ea3 c.37.1.8 (A:55-250) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
---|
>d1kk1a3 c.37.1.8 (A:6-200) Initiation factor eIF2 gamma subunit, N-terminal (G) domain {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
---|
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
---|
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
---|
>d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
---|
>d1jnya3 c.37.1.8 (A:4-227) Elongation factor eEF-1alpha, N-terminal (G) domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
---|
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
---|
>d1ni3a1 c.37.1.8 (A:11-306) YchF GTP-binding protein N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
---|
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
---|
>d1wxqa1 c.37.1.8 (A:1-319) GTP-binding protein PH0525 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
---|
>d1hyqa_ c.37.1.10 (A:) Cell division regulator MinD {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
---|
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
---|
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
---|
>d1jala1 c.37.1.8 (A:1-278) YchF GTP-binding protein N-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
---|
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
---|
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d1r5ba3 c.37.1.8 (A:215-459) Eukaryotic peptide chain release factor ERF2, G domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
---|
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
---|
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
---|
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} | Back information, alignment and structure |
---|
>d1zunb3 c.37.1.8 (B:16-237) Sulfate adenylate transferase subunit cysN/C, EF-Tu domain G-like domain {Pseudomonas syringae pv. tomato [TaxId: 323]} | Back information, alignment and structure |
---|
>d1gg4a4 c.72.2.1 (A:99-312) UDP-murNac-tripeptide D-alanyl-D-alanine-adding enzyme MurF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
---|