Diaphorina citri psyllid: psy8579


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MGFLIGEAPIRRTLKYLNAGRIVFKDKIKIFAINYNFNAENHRGAKEFVFWHFTQIQFKNPNVQLQVFKNMTPTPFITTYLENGSEMLIDVDNKSKDEIHDHVLKVLGKSEQVLKAEAIAREKKDNPANFGFKCEKHCICQIPGQITCPGLVRLPDSMRGKKVNPQGY
ccccccccHHHHHHHHHHcccEEEccccEEEEEEECccccccccHHHHHHHHcccccccccccEEEEEEccccccEEEEEEEcccEEEEEcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccEEEEEccccccccccccccccccccccccccc
**FLIGEAPIRRTLKYLNAGRIVFKDKIKIFAINYNFNAENHRGAKEFVFWHFTQIQFKNPNVQLQVFKNMTPTPFITTYLENGSEMLIDVDNKSKDEIHDHVLKVLGKSEQVLKAEAIA******PANFGFKCEKHCICQIPGQITCPGLVRLPDSMRGKK******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGFLIGEAPIRRTLKYLNAGRIVFKDKIKIFAINYNFNAENHRGAKEFVFWHFTQIQFKNPNVQLQVFKNMTPTPFITTYLENGSEMLIDVDNKSKDEIHDHVLKVLGKSEQVLKAEAIAREKKDNPANFGFKCEKHCICQIPGQITCPGLVRLPDSMRGKKVNPQGY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable 28S ribosomal protein S25, mitochondrial very confidentQ9VY28
Probable 28S ribosomal protein S25, mitochondrial confidentQ9N361
28S ribosomal protein S25, mitochondrial confidentQ4QR80

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003735 [MF]structural constituent of ribosomeprobableGO:0003674, GO:0005198
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005763 [CC]mitochondrial small ribosomal subunitprobableGO:0015935, GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0030529, GO:0005759, GO:0005761, GO:0000314, GO:0000313, GO:0044391, GO:0005840, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S3A, chain A
Confidence level:confident
Coverage over the Query: 28-110
View the alignment between query and template
View the model in PyMOL