Diaphorina citri psyllid: psy8579

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17

MGFLIGEAPIRRTLKYLNAGRIVFKDKIKIFAINYNFNAENHRGAKEFVFWHFTQIQFKNPNVQLQVFKNMTPTPFITTYLENGSEMLIDVDNKSKDEIHDHVLKVLGKSEQVLKAEAIAREKKDNPANFGFKCEKHCICQIPGQITCPGLVRLPDSMRGKKVNPQGY

ccccccccHHHHHHHHHHcccEEEccccEEEEEEECccccccccHHHHHHHHcccccccccccEEEEEEccccccEEEEEEEcccEEEEEcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccEEEEEccccccccccccccccccccccccccc

**FLIGEAPIRRTLKYLNAGRIVFKDKIKIFAINYNFNAENHRGAKEFVFWHFTQIQFKNPNVQLQVFKNMTPTPFITTYLENGSEMLIDVDNKSKDEIHDHVLKVLGKSEQVLKAEAIA******PANFGFKCEKHCICQIPGQITCPGLVRLPDSMRGKK******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MGFLIGEAPIRRTLKYLNAGRIVFKDKIKIFAINYNFNAENHRGAKEFVFWHFTQIQFKNPNVQLQVFKNMTPTPFITTYLENGSEMLIDVDNKSKDEIHDHVLKVLGKSEQVLKAEAIAREKKDNPANFGFKCEKHCICQIPGQITCPGLVRLPDSMRGKKVNPQGY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable 28S ribosomal protein S25, mitochondrial		very confident	Q9VY28
Probable 28S ribosomal protein S25, mitochondrial		confident	Q9N361
28S ribosomal protein S25, mitochondrial		confident	Q4QR80

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003735 [MF]	structural constituent of ribosome	probable	GO:0003674, GO:0005198
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0005763 [CC]	mitochondrial small ribosomal subunit	probable	GO:0015935, GO:0031974, GO:0043229, GO:0043228, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0005739, GO:0030529, GO:0005759, GO:0005761, GO:0000314, GO:0000313, GO:0044391, GO:0005840, GO:0032991, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S3A, chain A
Confidence level:confident
Coverage over the Query: 28-110
View the alignment between query and template
View the model in PyMOL