Diaphorina citri psyllid: psy8582

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
MEVLPNPVVFANNYEAFQQEDIEDSASIFLSNRLEQELRAAKSAQLACGEVLLPSDLLPNVARDILRLAEVEPYGLKGCTLFINFETDQECRKIATITCDPNTVSTFELYLTLRQDFRHSWHSLLPQFLKNLTKGGTIMISRGFTLEKKRLYRTYSDSIKE
ccccccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccHHHHHHHHHHHHcccccccccEEEEEEEEccccEEEEEEEEEccccccEEEEEEEEEEcccccccccHHHHHHccccccEEEEccccEEEEEcccccccccccc
**VLPNPVVFANNYEAFQQEDIEDSASIFLSNRLEQELRAAKSAQLACGEVLLPSDLLPNVARDILRLAEVEPYGLKGCTLFINFETDQECRKIATITCDPNTVSTFELYLTLRQDFRHSWHSLLPQFLKNLTKGGTIMISRGFTLEKKRLYRT****I**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEVLPNPVVFANNYEAFQQEDIEDSASIFLSNRLEQELRAAKSAQLACGEVLLPSDLLPNVARDILRLAEVEPYGLKGCTLFINFETDQECRKIATITCDPNTVSTFELYLTLRQDFRHSWHSLLPQFLKNLTKGGTIMISRGFTLEKKRLYRTYSDSIKE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DNA damage-inducible transcript 4-like protein Inhibits cell growth by regulating the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.confidentA2VDT9
DNA damage-inducible transcript 4-like protein Inhibits cell growth by regulating the TOR signaling pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.confidentQ8VHZ5
Protein charybde Inhibits cell growth by regulating the Tor pathway upstream of the Tsc1-Tsc2 complex and downstream of Akt1. Acts as cell death activator during head development.confidentQ2LZ58

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0010259 [BP]multicellular organismal agingprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LQ9, chain A
Confidence level:very confident
Coverage over the Query: 23-152
View the alignment between query and template
View the model in PyMOL