Diaphorina citri psyllid: psy8602


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MNVILQAFSHVPLIRNFFLSTIHKCKLDQYCFLCKIEALFNEFYNGNVEPIDLTKYRSDYCSEDEDEGVAPYELNLEDNRYELCSVIKHSGLNIDVGHYTTYISQHKRWFLCDDTKIKPVGITDVLNSEAYMLVYEKKVL
ccEEEEEccccccEEEEEEccccccccccCEEEHHHHcEEEccccccccccccccccccccccccccccccccccccccEEEEEEEEEECccccccccEEEEEcccccEEEEccccEEECcHHHHcccccEEEEEEEEcc
*NVILQAFSHVPLIRNFFLSTIHKCKLDQYCFLCKIEALFNEFYNGNVEPIDLTKYRSDY***************LEDNRYELCSVIKHSGLNIDVGHYTTYISQHKRWFLCDDTKIKPVGITDVLNSEAYMLVYEKKVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNVILQAFSHVPLIRNFFLSTIHKCKLDQYCFLCKIEALFNEFYNGNVEPIDLTKYRSDYCSEDEDEGVAPYELNLEDNRYELCSVIKHSGLNIDVGHYTTYISQHKRWFLCDDTKIKPVGITDVLNSEAYMLVYEKKVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 22 Histone deubiquitinating component of the transcription regulatory histone acetylation (HAT) complex SAGA. Catalyzes the deubiquitination of both histones H2A and H2B, thereby acting as a coactivator. Recruited to specific gene promoters by activators, where it is required for transcription.confidentA6H8I0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004843 [MF]ubiquitin-specific protease activityprobableGO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0000124 [CC]SAGA complexprobableGO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0070461, GO:0044428, GO:0044424, GO:0044422
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0016579 [BP]protein deubiquitinationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0070646, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NHE, chain A
Confidence level:very confident
Coverage over the Query: 9-139
View the alignment between query and template
View the model in PyMOL