Diaphorina citri psyllid: psy8608


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MFAAIAVKMVVAHLNDLENIPGFLIIALLYIMTDPGVMLACWLIRIYTLARFLHTVVYGIYVLPQPSRALCFTSGVLIEVYMIVIVIMAYHNY
cHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHcc
*FAAIAVKMVVAHLNDLENIPGFLIIALLYIMTDPGVMLACWLIRIYTLARFLHTVVYGIYVLPQPSRALCFTSGVLIEVYMIVIVIMAYHNY
xxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAAIAVKMVVAHLNDLENIPGFLIIALLYIMTDPGVMLACWLIRIYTLARFLHTVVYGIYVLPQPSRALCFTSGVLIEVYMIVIVIMAYHNY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Microsomal glutathione S-transferase 1 Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles. Has a wide substrate specificity.confidentQ64L89

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0003674 [MF]molecular_functionprobable
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2H8A, chain A
Confidence level:very confident
Coverage over the Query: 4-86
View the alignment between query and template
View the model in PyMOL