Diaphorina citri psyllid: psy8628


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MLHIARYGHWHKDRAQQQVKNVPRLIVFIIGGVSFSEIRCAYEVTNNVKNWEVIIGSSHIMTPEDFLNNLSNLSV
cccccccccccccccccccccccEEEEEEEccccHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHccccc
**HIARYGHWHKDRAQQQVKNVPRLIVFIIGGVSFSEIRCAYEVTNNVKNWEVIIGSSHIMTPEDFLNNLSNLS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLHIARYGHWHKDRAQQQVKNVPRLIVFIIGGVSFSEIRCAYEVTNNVKNWEVIIGSSHIMTPEDFLNNLSNLSV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein ROP May be a component of one of the vesicle trafficking pathways. May interact functionally with Ras2 protein.confidentQ07327
Syntaxin-binding protein 1 May participate in the regulation of synaptic vesicle docking and fusion, possibly through interaction with GTP-binding proteins. Essential for neurotransmission and binds syntaxins, components of the synaptic vesicle fusion machinery. May play a role in determining the specificity of intracellular fusion reactions.confidentQ6R748
Syntaxin-binding protein 1 May participate in the regulation of synaptic vesicle docking and fusion, possibly through interaction with GTP-binding proteins. Essential for neurotransmission and binds syntaxin, a component of the synaptic vesicle fusion machinery probably in a 1:1 ratio. Can interact with syntaxins 1, 2, and 3 but not syntaxin 4. May play a role in determining the specificity of intracellular fusion reactions.confidentQ5R6D2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0019898 [CC]extrinsic to membraneprobableGO:0005575, GO:0044425, GO:0016020
GO:0043195 [CC]terminal boutonprobableGO:0044306, GO:0043679, GO:0044463, GO:0044464, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0044456, GO:0045202, GO:0043005, GO:0033267, GO:0042995
GO:0006904 [BP]vesicle docking involved in exocytosisprobableGO:0046903, GO:0006810, GO:0016192, GO:0006887, GO:0044765, GO:0022406, GO:0048278, GO:0032940, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0032229 [BP]negative regulation of synaptic transmission, GABAergicprobableGO:0010646, GO:0044057, GO:0050794, GO:0031644, GO:0031645, GO:0051241, GO:0050805, GO:0050804, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0051239, GO:0023051, GO:0048519, GO:0051969, GO:0032228, GO:0051970, GO:0050789, GO:0048523
GO:0044422 [CC]organelle partprobableGO:0005575, GO:0043226
GO:0017075 [MF]syntaxin-1 bindingprobableGO:0003674, GO:0000149, GO:0019905, GO:0005488, GO:0005515
GO:0016079 [BP]synaptic vesicle exocytosisprobableGO:0019226, GO:0003001, GO:0035637, GO:0051648, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0006887, GO:0065007, GO:0051640, GO:0097479, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0007269, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0097480, GO:0051641, GO:0044700, GO:0046903, GO:0016192, GO:0044707, GO:0008150, GO:0006836
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0009416 [BP]response to light stimulusprobableGO:0009314, GO:0050896, GO:0008150, GO:0009628
GO:0016324 [CC]apical plasma membraneprobableGO:0045177, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0016323 [CC]basolateral plasma membraneprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0046928 [BP]regulation of neurotransmitter secretionprobableGO:0032879, GO:0051046, GO:0060341, GO:0010646, GO:0051049, GO:0050794, GO:0008150, GO:0031644, GO:0044057, GO:0065007, GO:0051239, GO:0023051, GO:0051588, GO:0051969, GO:0050804, GO:0050789
GO:0047485 [MF]protein N-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0045956 [BP]positive regulation of calcium ion-dependent exocytosisprobableGO:0045921, GO:0060341, GO:0051046, GO:0051047, GO:0051049, GO:0051050, GO:0060627, GO:0017158, GO:0065007, GO:0048518, GO:0008150, GO:0032879, GO:0017157, GO:0050789, GO:0050794, GO:0048522
GO:0006461 [BP]protein complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0007317 [BP]regulation of pole plasm oskar mRNA localizationprobableGO:2000241, GO:0051239, GO:0060341, GO:0050793, GO:0060281, GO:0060284, GO:0050794, GO:0008150, GO:0044087, GO:0045595, GO:2000026, GO:0045995, GO:0065007, GO:0032879, GO:0051128, GO:0050789
GO:0071705 [BP]nitrogen compound transportprobableGO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050821 [BP]protein stabilizationprobableGO:0019222, GO:0060255, GO:0010608, GO:0031647, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0031091 [CC]platelet alpha granuleprobableGO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0044194 [CC]cytolytic granuleprobableGO:0005737, GO:0005575, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005764, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0030027 [CC]lamellipodiumprobableGO:0005575, GO:0042995, GO:0044464, GO:0031252, GO:0005623
GO:0042581 [CC]specific granuleprobableGO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0042582 [CC]azurophil granuleprobableGO:0005737, GO:0005575, GO:0000323, GO:0043231, GO:0016023, GO:0030141, GO:0044444, GO:0044464, GO:0043229, GO:0005623, GO:0031988, GO:0005764, GO:0005773, GO:0005766, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0031201 [CC]SNARE complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425
GO:0070820 [CC]tertiary granuleprobableGO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0015758 [BP]glucose transportprobableGO:0008645, GO:0006810, GO:0008643, GO:0044765, GO:0008150, GO:0015749, GO:0071702, GO:0051234, GO:0051179, GO:0044699
GO:0000910 [BP]cytokinesisprobableGO:0009987, GO:0008150, GO:0044763, GO:0007049, GO:0051301, GO:0022402, GO:0044699
GO:0007399 [BP]nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0070527 [BP]platelet aggregationprobableGO:0016337, GO:0007596, GO:0007599, GO:0044699, GO:0009611, GO:0065007, GO:0022610, GO:0032501, GO:0050878, GO:0034109, GO:0009987, GO:0042060, GO:0006950, GO:0050817, GO:0008150, GO:0007155, GO:0030168, GO:0065008, GO:0044707, GO:0050896, GO:0001775, GO:0044763

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EPU, chain A
Confidence level:very confident
Coverage over the Query: 20-75
View the alignment between query and template
View the model in PyMOL