Diaphorina citri psyllid: psy8639

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570

MVSRCKFKKYLSNNEIFTSTPNMVSRCKFKKYLSNNEVCPKQIFTSTPNMVSRCKFKKYLSNNEIKEDVPIGFTVGNVVSTDSTGRAGGGHVMYSLTSLSPTDHSGAFDIDKSSGSLVVARQLDRETCPEYKLEVRALDTSTSSNPQSSAVAIKIEIVDVNDNAPRWGENPLTIPVNEDTLVGSTIWNFTATDADDGSNGELRYGLVRQYPEGNHFSVDHLTGTLTLLQPLDYETLTSFILVVKVTDQAANISERLSTSLTARVVVKDLNDNAPVFVSPTRGSLIYVSEQTRVGSHVTKMTAVDQDSGDNGRVTYVISGGNEDARFHLDHDKGILSLARVISEYDHQSKFRAVLNITASDHGIPPKSSSLVINILSETVSTSLPTFLSPSYHANVSEDAIPGTYIIKVVARSPSTYGNYVYTEVFLVSEDAIPGTYIIKVVARSPSTYVYHMYLISDFSGYNLTYMIPAGVADDMFKIDAETGVVTLARSLDRETVDQYNLVVHVTDSKSGDYDTTNVFITILDVNDNAPEFKSGSCYPITIPENSEAANVHTFIATDFGNFHKSFIDSS

ccccEEEEEEEECcCEEEcccccCEEEEEEEEEEccccccccEEcccccccccccccccEEEEEECcccccccEEEEEEECccccccccCEEEEEEECcccccccccEEECccccEEEEccccccccccEEEEEEEEECccccccccCEEEEEEEEEEEccccccccccccEEEEEccccccccEEEEEEEECcccccccEEEEEEECcccccccEEECccccEEEEccccccccccEEEEEEEEEEcccccccccEEEEEEEEEEEEccccccEEEccccccEEECcccccccEEEEEEEEEcccccccCEEEEEEEEccccccEEEEcccccEEEEEcccccccEEEcEEEEEEEEECcccccccCEEEEEEEEEEcccccccccccCEEEEECcccccccEEEEEEEEccccccccEEEEEEEEcccccccEEEEEEEEcccccEEEEEEEEccccccCEEEECccccccccEEEEccccEEEEccccccccccCEEEEEEEECcccccccEEEEEEEEEEccccccccccccccEEECcccccccEEEEEEEECccccccEEEEcc

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	probable	GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0042995 [CC]	cell projection	probable	GO:0005575, GO:0044464, GO:0005623
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0044763 [BP]	single-organism cellular process	probable	GO:0009987, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q55, chain A
Confidence level:very confident
Coverage over the Query: 62-415,458-566
View the alignment between query and template
View the model in PyMOL

Template: 1Q55, chain A
Confidence level:very confident
Coverage over the Query: 173-415,458-569
View the alignment between query and template
View the model in PyMOL

Template: 3Q2W, chain A
Confidence level:very confident
Coverage over the Query: 5-40,55-415,458-523
View the alignment between query and template
View the model in PyMOL

Template: 2WCP, chain A
Confidence level:probable
Coverage over the Query: 56-269
View the alignment between query and template
View the model in PyMOL