Diaphorina citri psyllid: psy863


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MVLWCILLIIVPIHVTSNTRDSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDDIQVSAITDLIQSHVPDASLHNTQSSQITYTLPTQDTSPFPALFATLEEKKSALGISSIGIACTTIEEVFLKVGDLASKEKIESVDAKSKRSTLEQVPNGESNKEPLLHQKVQGVLFLVFLLFATAMLLFTYSYSLIVQGPESLGYYFVLNVVFGK
ccHHHHHHHcccHHHHHHcHHHHHHHHcccccEEEEEccHHHccccccccCEEEEEEEcccccHHHHHHHHHHHccccEEEECcccEEEEEccccccccHHHHHHHHHHccccccccEEEcccccHHHHHHHHccccccccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccc
MVLWCILLIIVPIHVTSNTRDSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDDIQVSAITDLIQSHVPDASLHNTQSSQITYTLPTQDTSPFPALFATLEEKKSALGISSIGIACTTIEEVFLKVGDL*******************************LHQKVQGVLFLVFLLFATAMLLFTYSYSLIVQGPESLGYYFVLNVVFGK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLWCILLIIVPIHVTSNTRDSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDDIQVSAITDLIQSHVPDASLHNTQSSQITYTLPTQDTSPFPALFATLEEKKSALGISSIGIACTTIEEVFLKVGDLASKEKIESVDAKSKRSTLEQVPNGESNKEPLLHQKVQGVLFLVFLLFATAMLLFTYSYSLIVQGPESLGYYFVLNVVFGK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0022892 [MF]substrate-specific transporter activityprobableGO:0005215, GO:0003674
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0006810 [BP]transportprobableGO:0051234, GO:0008150, GO:0051179
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VPL, chain A
Confidence level:probable
Coverage over the Query: 2-48
View the alignment between query and template
View the model in PyMOL
Template: 3ARC, chain K
Confidence level:probable
Coverage over the Query: 172-194
View the alignment between query and template
View the model in PyMOL