Psyllid ID: psy863

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------

MVLWCILLIIVPIHVTSNTRDSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDDIQVSAITDLIQSHVPDASLHNTQSSQITYTLPTQDTSPFPALFATLEEKKSALGISSIGIACTTIEEVFLKVGDLASKEKIESVDAKSKRSTLEQVPNGESNKEPLLHQKVQGVLFLVFLLFATAMLLFTYSYSLIVQGPESLGYYFVLNVVFGK

ccHHHHHHHcccHHHHHHcHHHHHHHHcccccEEEEEccHHHccccccccEEEEEEEEcccccHHHHHHHHHHHccccEEEEEcccEEEEEccccccccHHHHHHHHHHccccccccEEEcccccHHHHHHHHcccccccHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHcccccc

ccHHHHHHHHHHHccHHHHHHHHHHHHHHHcccEEEcccHHHHccccccccEEEEEEEcccccHHHHHHHHHHHccccEEEHccccEEEEEcccccccHHHHHHHHHHHHHHHcccccccEEEccHHHHEEEEccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEccc

MVLWCILLIIVpihvtsntRDSIRLLATYFPGYAMICGFKllgnfeangagyqltfltsddiqVSAITDLIqshvpdaslhntqssqitytlptqdtspfpaLFATLEEKKSALGISSIGIACTTIEEVFLKVGdlaskekiesvdakskrstleqvpngesnkepllhqkvQGVLFLVFLLFATAMLLFTYSYSLIvqgpeslgYYFVLNVVFGK

MVLWCILLIIVPihvtsntrDSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDDIQVSAITDLIQSHVPDASLHNTQSSQITYTLPTQDTSPFPALFATLEEKKSALGISSIGIACTTIEEVFLKVGDLASKEkiesvdakskrstleqvpngesnkepllHQKVQGVLFLVFLLFATAMLLFTYSYSLIVQGPESLGYYFVLNVVFGK

*VLWCILLIIVPIHVTSNTRDSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDDIQVSAITDLIQSHVP***********ITYTLPT**TSPFPALFATLEEKKSALGISSIGIACTTIEEVFLKVGDL*******************************LHQKVQGVLFLVFLLFATAMLLFTYSYSLIVQGPESLGYYFVLNVVF**

MVLWCILLIIVPIHVTSNTRDSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDDIQVSAITDLIQSHVPDASLHNTQSSQITYTLPTQDTSPFPALFATLEEKKSALGISSIGIACTTIEEVFLK***************************************VQGVLFLVFLLFATAMLLFTYSYSLIVQGPESLGYYFVLNVVFGK

MVLWCILLIIVPIHVTSNTRDSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDDIQVSAITDLIQSHVPDASLHNTQSSQITYTLPTQDTSPFPALFATLEEKKSALGISSIGIACTTIEEVFLKVGDL*****************************PLLHQKVQGVLFLVFLLFATAMLLFTYSYSLIVQGPESLGYYFVLNVVFGK

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo

ooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii

SSSSSSSSSSSSSSSoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooo

SSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		216	2.2.26 [Sep-21-2011]
Q99758		1704	ATP-binding cassette sub-	yes	N/A	0.518	0.065	0.379	7e-16
Q8R420		1704	ATP-binding cassette sub-	yes	N/A	0.518	0.065	0.387	8e-16
Q8WWZ4		1543	ATP-binding cassette sub-	no	N/A	0.5	0.069	0.319	4e-11
Q8K442		1620	ATP-binding cassette sub-	no	N/A	0.462	0.061	0.330	1e-10
P41233		2261	ATP-binding cassette sub-	no	N/A	0.472	0.045	0.383	2e-10
Q8CF82		1642	ATP-binding cassette sub-	no	N/A	0.564	0.074	0.3	3e-10
Q8K448		1642	ATP-binding cassette sub-	no	N/A	0.564	0.074	0.292	5e-10
O94911		1581	ATP-binding cassette sub-	no	N/A	0.5	0.068	0.327	6e-10
Q8T6J2		1662	ABC transporter A family	yes	N/A	0.5	0.064	0.321	7e-10
O95477		2261	ATP-binding cassette sub-	no	N/A	0.425	0.040	0.4	9e-10

>sp\|Q99758\|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2	Back alignment and function desciption

 Score = 84.0 bits (206), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 67/116 (57%), Gaps = 4/116 (3%)

Query: 21  DSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDDIQVSAITDLIQSHVPDASL 80
           D I ++A    G    CG  L    +  GAGY +T +         I+ L+  HVP+A+L
Sbjct: 731 DRIAIMAK---GELQCCGSSLFLK-QKYGAGYHMTLVKEPHCNPEDISQLVHHHVPNATL 786

Query: 81  HNTQSSQITYTLPTQDTSPFPALFATLEEKKSALGISSIGIACTTIEEVFLKVGDL 136
            ++  +++++ LP + T  F  LFA LE+K+  LGI+S G + TT+EEVFL+VG L
Sbjct: 787 ESSAGAELSFILPRESTHRFEGLFAKLEKKQKELGIASFGASITTMEEVFLRVGKL 842

Plays an important role in the formation of pulmonary surfactant, probably by transporting lipids such as cholesterol.
Homo sapiens (taxid: 9606)

>sp\|Q8R420\|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=2 SV=3	Back alignment and function description

>sp\|Q8WWZ4\|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3	Back alignment and function description

>sp\|Q8K442\|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=2 SV=2	Back alignment and function description

>sp\|P41233\|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4	Back alignment and function description

>sp\|Q8CF82\|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1	Back alignment and function description

>sp\|Q8K448\|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2	Back alignment and function description

>sp\|O94911\|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3	Back alignment and function description

>sp\|Q8T6J2\|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1	Back alignment and function description

>sp\|O95477\|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		216
47551267		1764	ATP-binding cassette transporter subfami	0.754	0.092	0.313	7e-18
405974925		1716	ATP-binding cassette sub-family A member	0.578	0.072	0.401	5e-17
357619167		1632	putative ATP-binding cassette sub-family	0.518	0.068	0.433	4e-16
335284527		1813	PREDICTED: ATP-binding cassette sub-fami	0.625	0.074	0.349	2e-15
166091513		1704	ATP-binding cassette sub-family A member	0.518	0.065	0.396	2e-15
440913505		1696	ATP-binding cassette sub-family A member	0.518	0.066	0.396	2e-15
334332954		1513	PREDICTED: ATP-binding cassette sub-fami	0.662	0.094	0.348	3e-15
320167955		1917	ATP-binding cassette transporter 1 [Caps	0.541	0.061	0.384	4e-15
405945282		1191	ATP-binding cassette sub-family A member	0.574	0.104	0.352	6e-15
395515887		1799	PREDICTED: ATP-binding cassette sub-fami	0.560	0.067	0.372	7e-15

>gi\|47551267\|ref\|NP_999814.1\| ATP-binding cassette transporter subfamily A [Strongylocentrotus purpuratus] gi\|22218268\|gb\|AAM94613.1\| ATP-binding cassette transporter subfamily A [Strongylocentrotus purpuratus]	Back alignment and taxonomy information

 Score = 96.3 bits (238), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 101/188 (53%), Gaps = 25/188 (13%)

Query: 49  GAGYQLTFLTSDDIQVSAITDLIQSHVPDASLHNTQSSQITYTLPTQDTSPFPALFATLE 108
           G GY LT + ++ + +++I  +I++H+P+ASL +   S+I Y LP + +S F  LF  LE
Sbjct: 741 GIGYHLTLVQNEKVDMNSIQHMIKNHIPNASLESRVGSEIDYILPRESSSTFKDLFTQLE 800

Query: 109 EKKSALGISSIGIACTTIEEVFLKVGDLASKEKIESVDAKSKRSTLEQVP---------- 158
            ++  LGI S G++ TT+EEVF+KVG++  +E+        +RS+L   P          
Sbjct: 801 NERGPLGIDSFGVSVTTMEEVFMKVGEMVDEEEANGGGMMRRRSSLIPPPRPAQADPVIY 860

Query: 159 -NGESN-KEPLLHQKVQGV----------LFLVFLLFATAMLLFTYSYSLIVQGPESLGY 206
            NGE+  K+P +   + G+          +FL FL F     +F   +   ++  +S+  
Sbjct: 861 TNGEAGVKDPNVKISLFGINSGQSALVTGIFLKFLQFKA---IFIKRFLCALRDKKSVIT 917

Query: 207 YFVLNVVF 214
            F+L +VF
Sbjct: 918 QFILPIVF 925

Source: Strongylocentrotus purpuratus

Species: Strongylocentrotus purpuratus

Genus: Strongylocentrotus

Family: Strongylocentrotidae

Order: Echinoida

Class: Echinoidea

Phylum: Echinodermata

Superkingdom: Eukaryota

>gi\|405974925\|gb\|EKC39537.1\| ATP-binding cassette sub-family A member 3 [Crassostrea gigas]	Back alignment and taxonomy information

>gi\|357619167\|gb\|EHJ71844.1\| putative ATP-binding cassette sub-family A member 3 [Danaus plexippus]	Back alignment and taxonomy information

>gi\|335284527\|ref\|XP_003354628.1\| PREDICTED: ATP-binding cassette sub-family A member 3-like [Sus scrofa]	Back alignment and taxonomy information

>gi\|166091513\|ref\|NP_001107218.1\| ATP-binding cassette sub-family A member 3 [Bos taurus] gi\|296473435\|tpg\|DAA15550.1\| TPA: ATP-binding cassette, sub-family A (ABC1), member 3 [Bos taurus]	Back alignment and taxonomy information

>gi\|440913505\|gb\|ELR62954.1\| ATP-binding cassette sub-family A member 3 [Bos grunniens mutus]	Back alignment and taxonomy information

>gi\|334332954\|ref\|XP_001377117.2\| PREDICTED: ATP-binding cassette sub-family A member 3-like [Monodelphis domestica]	Back alignment and taxonomy information

>gi\|320167955\|gb\|EFW44854.1\| ATP-binding cassette transporter 1 [Capsaspora owczarzaki ATCC 30864]	Back alignment and taxonomy information

>gi\|405945282\|gb\|EKC17257.1\| ATP-binding cassette sub-family A member 3 [Crassostrea gigas]	Back alignment and taxonomy information

>gi\|395515887\|ref\|XP_003762130.1\| PREDICTED: ATP-binding cassette sub-family A member 3-like [Sarcophilus harrisii]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		216
UNIPROTKB\|E1BCR1		1704	ABCA3 "Uncharacterized protein	0.560	0.071	0.380	1.4e-15
UNIPROTKB\|E2R3M5		1776	E2R3M5 "Uncharacterized protei	0.615	0.074	0.316	2.4e-15
ZFIN\|ZDB-GENE-050517-2		1292	abca3b "ATP-binding cassette,	0.555	0.092	0.401	4.2e-15
UNIPROTKB\|F1RPC9		1618	LOC100622606 "Uncharacterized	0.638	0.085	0.348	9.1e-15
UNIPROTKB\|F1RFA0		1702	ABCA3 "Uncharacterized protein	0.518	0.065	0.379	9.7e-15
UNIPROTKB\|H0Y3H2		1646	ABCA3 "ATP-binding cassette su	0.560	0.073	0.365	1.2e-14
UNIPROTKB\|Q99758		1704	ABCA3 "ATP-binding cassette su	0.560	0.071	0.365	1.2e-14
UNIPROTKB\|F1Q1F1		1702	ABCA3 "Uncharacterized protein	0.518	0.065	0.379	1.6e-14
UNIPROTKB\|G3N2H7		1585	Bt.71354 "Uncharacterized prot	0.643	0.087	0.335	1.9e-14
UNIPROTKB\|F1N096		1684	Bt.71354 "Uncharacterized prot	0.643	0.082	0.335	2e-14

UNIPROTKB\|E1BCR1 ABCA3 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

 Score = 211 (79.3 bits), Expect = 1.4e-15, P = 1.4e-15
 Identities = 48/126 (38%), Positives = 74/126 (58%)

Query:    21 DSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDDIQVSAITDLIQSHVPDASL 80
             D I ++A    G    CG  L    E  GAGY +T +         I+ L+Q HVP+A+L
Sbjct:   731 DRIAIMAK---GELQCCGSSLFLK-EKYGAGYHMTLVKEPHCNPEGISRLVQHHVPNATL 786

Query:    81 HNTQSSQITYTLPTQDTSPFPALFATLEEKKSALGISSIGIACTTIEEVFLKVGDLA-SK 139
              ++  +++++ LP + T  F +LFA LE+K+  LGI+S G + TT+EEVFL+VG L  S 
Sbjct:   787 ESSAGAELSFILPKESTHRFESLFAKLEKKQKELGIASFGASVTTMEEVFLRVGKLVDSS 846

Query:   140 EKIESV 145
               I+++
Sbjct:   847 MDIQAI 852

GO:0097233 "alveolar lamellar body membrane" evidence=IEA

GO:0006810 "transport" evidence=IEA

GO:0005886 "plasma membrane" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0016887 "ATPase activity" evidence=IEA

UNIPROTKB\|E2R3M5 E2R3M5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

ZFIN\|ZDB-GENE-050517-2 abca3b "ATP-binding cassette, sub-family A (ABC1), member 3b" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RPC9 LOC100622606 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RFA0 ABCA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|H0Y3H2 ABCA3 "ATP-binding cassette sub-family A member 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q99758 ABCA3 "ATP-binding cassette sub-family A member 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1Q1F1 ABCA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|G3N2H7 Bt.71354 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N096 Bt.71354 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		216
TIGR01257		2272	TIGR01257, rim_protein, retinal-specific rim ABC t	2e-09

>gnl\|CDD\|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter	Back alignment and domain information

 Score = 56.9 bits (137), Expect = 2e-09
 Identities = 33/93 (35%), Positives = 53/93 (56%), Gaps = 2/93 (2%)

Query: 61   DIQVSAITDLIQSHVPDASLHNTQSSQITYTLPTQD--TSPFPALFATLEEKKSALGISS 118
            D  V+ + DL+  HVP+A L      ++ + LP ++     + +LF  LEE  + LG+SS
Sbjct: 1202 DGDVNELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADLGLSS 1261

Query: 119  IGIACTTIEEVFLKVGDLASKEKIESVDAKSKR 151
             GI+ T +EE+FLKV + A    + +  A+ KR
Sbjct: 1262 FGISDTPLEEIFLKVTEDADSGSLFAGGAQQKR 1294

This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease [Transport and binding proteins, Other]. Length = 2272

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		216
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.86
KOG0059\|consensus		885		99.82
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.68
COG4152		300	ABC-type uncharacterized transport system, ATPase	99.46
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	99.32
PRK13537		306	nodulation ABC transporter NodI; Provisional	99.29
PRK13536		340	nodulation factor exporter subunit NodI; Provision	99.27
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	99.23
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	99.1
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	99.1
COG4586		325	ABC-type uncharacterized transport system, ATPase	99.09
COG4555		245	NatA ABC-type Na+ transport system, ATPase compone	98.96
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	98.26
PF13732		84	DUF4162: Domain of unknown function (DUF4162)	98.17
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	98.16
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	98.15
TIGR03265		353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	98.07
TIGR02314		343	ABC_MetN D-methionine ABC transporter, ATP-binding	98.04
PRK09536		402	btuD corrinoid ABC transporter ATPase; Reviewed	98.04
COG1127		263	Ttg2A ABC-type transport system involved in resist	98.02
TIGR03258		362	PhnT 2-aminoethylphosphonate ABC transport system,	98.0
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	97.98
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	97.98
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	97.97
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	97.96
COG1123		539	ATPase components of various ABC-type transport sy	97.96
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	97.96
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	97.96
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	97.96
TIGR01187		325	potA spermidine/putrescine ABC transporter ATP-bin	97.95
COG1135		339	AbcC ABC-type metal ion transport system, ATPase c	97.94
PRK11650		356	ugpC glycerol-3-phosphate transporter ATP-binding	97.93
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	97.93
PRK10851		353	sulfate/thiosulfate transporter subunit; Provision	97.92
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	97.92
KOG0059\|consensus		885		97.92
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	97.92
COG0444		316	DppD ABC-type dipeptide/oligopeptide/nickel transp	97.9
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	97.9
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	97.9
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	97.89
COG1118		345	CysA ABC-type sulfate/molybdate transport systems,	97.88
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	97.88
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	97.87
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	97.87
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	97.85
PRK15079		331	oligopeptide ABC transporter ATP-binding protein O	97.85
PRK11144		352	modC molybdate transporter ATP-binding protein; Pr	97.83
PRK09452		375	potA putrescine/spermidine ABC transporter ATPase	97.83
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	97.83
PRK11000		369	maltose/maltodextrin transporter ATP-binding prote	97.81
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	97.81
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	97.81
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	97.81
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	97.79
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	97.79
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	97.79
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	97.78
TIGR02142		354	modC_ABC molybdenum ABC transporter, ATP-binding p	97.77
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	97.77
PRK14257		329	phosphate ABC transporter ATP-binding protein; Pro	97.76
PRK14270		251	phosphate ABC transporter ATP-binding protein; Pro	97.75
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	97.75
PRK03695		248	vitamin B12-transporter ATPase; Provisional	97.75
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	97.75
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	97.75
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	97.74
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	97.74
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	97.74
COG4148		352	ModC ABC-type molybdate transport system, ATPase c	97.74
PRK13639		275	cbiO cobalt transporter ATP-binding subunit; Provi	97.74
PRK14245		250	phosphate ABC transporter ATP-binding protein; Pro	97.73
PRK14256		252	phosphate ABC transporter ATP-binding protein; Pro	97.73
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	97.73
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	97.73
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	97.72
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	97.72
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	97.72
PRK14267		253	phosphate ABC transporter ATP-binding protein; Pro	97.71
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	97.7
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	97.7
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	97.7
cd03299		235	ABC_ModC_like Archeal protein closely related to M	97.7
TIGR03873		256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	97.69
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	97.69
PRK10261		623	glutathione transporter ATP-binding protein; Provi	97.67
PRK14253		249	phosphate ABC transporter ATP-binding protein; Pro	97.67
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	97.66
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	97.66
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	97.65
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	97.65
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	97.64
PRK13546		264	teichoic acids export protein ATP-binding subunit;	97.64
PRK14240		250	phosphate transporter ATP-binding protein; Provisi	97.64
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	97.63
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	97.63
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	97.63
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	97.63
PRK11231		255	fecE iron-dicitrate transporter ATP-binding subuni	97.63
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	97.62
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	97.62
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	97.62
PRK13644		274	cbiO cobalt transporter ATP-binding subunit; Provi	97.61
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	97.61
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	97.61
PRK09984		262	phosphonate/organophosphate ester transporter subu	97.6
PRK10418		254	nikD nickel transporter ATP-binding protein NikD;	97.59
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	97.59
PRK14249		251	phosphate ABC transporter ATP-binding protein; Pro	97.59
COG1137		243	YhbG ABC-type (unclassified) transport system, ATP	97.59
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	97.59
COG1123		539	ATPase components of various ABC-type transport sy	97.59
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	97.58
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	97.58
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	97.58
PRK14251		251	phosphate ABC transporter ATP-binding protein; Pro	97.58
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	97.57
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	97.57
PRK14272		252	phosphate ABC transporter ATP-binding protein; Pro	97.57
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	97.57
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	97.56
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	97.56
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	97.55
PRK14258		261	phosphate ABC transporter ATP-binding protein; Pro	97.55
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	97.55
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	97.55
PRK14263		261	phosphate ABC transporter ATP-binding protein; Pro	97.54
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	97.54
PRK14252		265	phosphate ABC transporter ATP-binding protein; Pro	97.54
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	97.53
PRK10261		623	glutathione transporter ATP-binding protein; Provi	97.52
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	97.52
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	97.52
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	97.52
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	97.51
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	97.51
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	97.51
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	97.5
PRK13545		549	tagH teichoic acids export protein ATP-binding sub	97.49
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	97.49
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	97.48
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	97.48
PRK14266		250	phosphate ABC transporter ATP-binding protein; Pro	97.48
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	97.48
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	97.48
PRK14271		276	phosphate ABC transporter ATP-binding protein; Pro	97.48
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	97.47
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	97.45
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	97.45
cd03289		275	ABCC_CFTR2 The CFTR subfamily domain 2. The cystic	97.45
PRK14255		252	phosphate ABC transporter ATP-binding protein; Pro	97.44
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	97.43
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	97.42
PRK10938		490	putative molybdenum transport ATP-binding protein	97.41
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	97.37
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	97.35
PRK14264		305	phosphate ABC transporter ATP-binding protein; Pro	97.32
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	97.3
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	97.27
PRK14254		285	phosphate ABC transporter ATP-binding protein; Pro	97.26
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	97.26
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	97.22
COG4172		534	ABC-type uncharacterized transport system, duplica	97.2
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	97.18
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	97.17
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	97.15
COG4172		534	ABC-type uncharacterized transport system, duplica	97.05
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	97.01
COG3638		258	ABC-type phosphate/phosphonate transport system, A	96.95
PRK15064		530	ABC transporter ATP-binding protein; Provisional	96.94
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	96.93
PLN03211		659	ABC transporter G-25; Provisional	96.75
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	96.73
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	96.71
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	96.7
COG4559		259	ABC-type hemin transport system, ATPase component	96.64
TIGR00955		617	3a01204 The Eye Pigment Precursor Transporter (EPP	96.5
TIGR01192		585	chvA glucan exporter ATP-binding protein. This mod	96.45
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	96.38
COG3845		501	ABC-type uncharacterized transport systems, ATPase	96.35
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	96.34
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	96.3
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	96.27
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	96.26
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	96.2
PRK10535		648	macrolide transporter ATP-binding /permease protei	96.13
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	96.11
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	96.1
COG4988		559	CydD ABC-type transport system involved in cytochr	96.08
PRK00349		943	uvrA excinuclease ABC subunit A; Reviewed	96.02
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	96.01
TIGR00630		924	uvra excinuclease ABC, A subunit. This family is b	95.95
PRK11147		635	ABC transporter ATPase component; Reviewed	95.93
PRK00349		943	uvrA excinuclease ABC subunit A; Reviewed	95.89
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	95.85
PLN03073		718	ABC transporter F family; Provisional	95.82
PLN03232		1495	ABC transporter C family member; Provisional	95.75
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	95.72
PLN03130		1622	ABC transporter C family member; Provisional	95.65
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	95.62
PLN03140		1470	ABC transporter G family member; Provisional	95.58
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	95.44
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	95.36
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	95.26
PTZ00243		1560	ABC transporter; Provisional	95.16
COG4604		252	CeuD ABC-type enterochelin transport system, ATPas	95.02
PRK00635		1809	excinuclease ABC subunit A; Provisional	95.01
PRK13409		590	putative ATPase RIL; Provisional	94.88
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	94.82
PLN03140		1470	ABC transporter G family member; Provisional	94.75
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	94.66
KOG0054\|consensus		1381		94.39
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	94.38
PRK11147		635	ABC transporter ATPase component; Reviewed	94.36
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	94.22
COG4107		258	PhnK ABC-type phosphonate transport system, ATPase	94.2
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	94.09
KOG0055\|consensus		1228		94.03
PTZ00243		1560	ABC transporter; Provisional	93.59
COG4598		256	HisP ABC-type histidine transport system, ATPase c	93.36
cd03285		222	ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS	93.25
PRK00635		1809	excinuclease ABC subunit A; Provisional	93.09
PRK07721		438	fliI flagellum-specific ATP synthase; Validated	92.52
PLN03130		1622	ABC transporter C family member; Provisional	92.3
COG4138		248	BtuD ABC-type cobalamin transport system, ATPase c	92.18
PLN03232		1495	ABC transporter C family member; Provisional	92.17
cd03280		200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	91.74
PRK13409		590	putative ATPase RIL; Provisional	91.72
COG4167		267	SapF ABC-type antimicrobial peptide transport syst	91.13
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	90.39
KOG0058\|consensus		716		90.09
KOG0054\|consensus		1381		88.77
cd03243		202	ABC_MutS_homologs The MutS protein initiates DNA m	88.61
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	88.04
COG4525		259	TauB ABC-type taurine transport system, ATPase com	86.95
KOG0057\|consensus		591		86.6
cd03284		216	ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr	86.45
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	82.89
COG4170		330	SapD ABC-type antimicrobial peptide transport syst	82.53
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	80.66

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

Probab=99.86  E-value=7.8e-21  Score=189.85  Aligned_cols=136  Identities=32%  Similarity=0.489  Sum_probs=121.1

Q ss_pred             hhhhhHH-------hhhcCCChhHHHhhhceEEEeeCCEEEEEeccccccccccCceEEEEEEECCc-------------
Q psy863            2 VLWCILL-------IIVPIHVTSNTRDSIRLLATYFPGYAMICGFKLLGNFEANGAGYQLTFLTSDD-------------   61 (216)
Q Consensus         2 ~iw~lI~-------IilSTH~L~EaE~lcDrI~Il~~G~li~~Gs~~~L~k~~~~~~~~l~~~~~~~-------------   61 (216)
                      .+|++|+       ||+|||+|+|++.+||||++|++|++++.|++.+| |+++|.+|.+++...+.             
T Consensus      1099 ~l~~lL~~l~~g~TIIltTHdmdea~~laDrI~iL~~GkL~~~Gs~~~L-k~~~g~gy~l~~~~~~~~~~~~~~~~~~~~ 1177 (2272)
T TIGR01257      1099 SIWDLLLKYRSGRTIIMSTHHMDEADLLGDRIAIISQGRLYCSGTPLFL-KNCFGTGFYLTLVRKMKNIQSQRGGCEGTC 1177 (2272)
T ss_pred             HHHHHHHHHhCCCEEEEEECCHHHHHHhCCEEEEEECCEEEEecCHHHH-HHhcCCcEEEEEEecccccccccccccccc
Confidence            5788887       99999999999999999999999999999999999 99999999999865420             


Q ss_pred             -------------------------cCHHHHHHHHHhhCCCcEEeeecCcEEEEEecCCCC--CcHHHHHHHHHhhhhhC
Q psy863           62 -------------------------IQVSAITDLIQSHVPDASLHNTQSSQITYTLPTQDT--SPFPALFATLEEKKSAL  114 (216)
Q Consensus        62 -------------------------~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~l~~~l~~~~~~~  114 (216)
                                               .+.+.+.+++++++|++...+..+.++.+.+|.+..  ..++.+++.|++...++
T Consensus      1178 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~v~~~iP~a~l~~~~g~el~y~LP~~~~~~~~f~~lf~~Le~~~~~l 1257 (2272)
T TIGR01257      1178 SCTSKGFSTRCPARVDEITPEQVLDGDVNELMDLVYHHVPEAKLVECIGQELIFLLPNKNFKQRAYASLFRELEETLADL 1257 (2272)
T ss_pred             cccccccccccccccccccccccccccHHHHHHHHHHhCCCcEEEeccCCEEEEEecccccccchHHHHHHHHHhhHhhC
Confidence                                     135668888999999999999999999999998764  35899999999888899


Q ss_pred             CcceEEeecCCHHHHHHhhccccc
Q psy863          115 GISSIGIACTTIEEVFLKVGDLAS  138 (216)
Q Consensus       115 ~i~~~~~~~~sLEdvFl~l~~~~~  138 (216)
                      +|.+|.++.+||||||+++.++.+
T Consensus      1258 gi~sygis~tTLEeVFlkv~~~~~ 1281 (2272)
T TIGR01257      1258 GLSSFGISDTPLEEIFLKVTEDAD 1281 (2272)
T ss_pred             CCceEEeecCCHHHHHHHhhhhcc
Confidence            999999999999999999987654

>KOG0059\|consensus	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>PRK13536 nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PF13732 DUF4162: Domain of unknown function (DUF4162)	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit	Back alignment and domain information

>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>KOG0059\|consensus	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>cd03299 ABC_ModC_like Archeal protein closely related to ModC	Back alignment and domain information

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14240 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional	Back alignment and domain information

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2	Back alignment and domain information

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PLN03211 ABC transporter G-25; Provisional	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein	Back alignment and domain information

>TIGR01192 chvA glucan exporter ATP-binding protein	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>TIGR00630 uvra excinuclease ABC, A subunit	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK00635 excinuclease ABC subunit A; Provisional	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>KOG0054\|consensus	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>KOG0055\|consensus	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes	Back alignment and domain information

>PRK00635 excinuclease ABC subunit A; Provisional	Back alignment and domain information

>PRK07721 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>KOG0058\|consensus	Back alignment and domain information

>KOG0054\|consensus	Back alignment and domain information

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>KOG0057\|consensus	Back alignment and domain information

>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		216
4g1u_C		266	Hemin import ATP-binding protein HMUV; membrane tr	98.27
3fvq_A		359	Fe(3+) IONS import ATP-binding protein FBPC; nucle	98.26
3tui_C		366	Methionine import ATP-binding protein METN; ABC-tr	98.22
3rlf_A		381	Maltose/maltodextrin import ATP-binding protein M;	98.22
1b0u_A		262	Histidine permease; ABC transporter, transport pro	98.16
3gfo_A		275	Cobalt import ATP-binding protein CBIO 1; structur	98.13
2olj_A		263	Amino acid ABC transporter; ABC domain, ATPase, hy	98.13
1oxx_K		353	GLCV, glucose, ABC transporter, ATP binding protei	98.11
1z47_A		355	CYSA, putative ABC-transporter ATP-binding protein	98.11
2yyz_A		359	Sugar ABC transporter, ATP-binding protein; sugar	98.11
2onk_A		240	Molybdate/tungstate ABC transporter, ATP-binding p	98.1
1vpl_A		256	ABC transporter, ATP-binding protein; TM0544, stru	98.1
2it1_A		362	362AA long hypothetical maltose/maltodextrin trans	98.08
1g29_1		372	MALK, maltose transport protein MALK; ATPase, acti	98.08
1v43_A		372	Sugar-binding transport ATP-binding protein; ATPas	98.06
3d31_A		348	Sulfate/molybdate ABC transporter, ATP-binding pro	98.06
1g6h_A		257	High-affinity branched-chain amino acid transport	98.0
2qi9_C		249	Vitamin B12 import ATP-binding protein BTUD; inner	97.96
2ihy_A		279	ABC transporter, ATP-binding protein; ATPase, ABC	97.91
2yz2_A		266	Putative ABC transporter ATP-binding protein TM_0;	97.9
2pjz_A		263	Hypothetical protein ST1066; ATP binding protein,	97.83
3nh6_A		306	ATP-binding cassette SUB-family B member 6, mitoc;	97.8
2nq2_C		253	Hypothetical ABC transporter ATP-binding protein H	97.73
2d2e_A		250	SUFC protein; ABC-ATPase, SUF protein, 310-helix,	97.73
2ixe_A		271	Antigen peptide transporter 1; ABC ATPase, hydrola	97.72
2ghi_A		260	Transport protein; multidrug resistance protein, M	97.64
1mv5_A		243	LMRA, multidrug resistance ABC transporter ATP-bin	97.64
3gd7_A		390	Fusion complex of cystic fibrosis transmembrane co	97.53
2yl4_A		595	ATP-binding cassette SUB-family B member 10, mitoc	97.38
3ux8_A		670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	97.38
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	97.35
2bbs_A		290	Cystic fibrosis transmembrane conductance regulato	97.29
2cbz_A		237	Multidrug resistance-associated protein 1; ABC pro	97.26
3qf4_B		598	Uncharacterized ABC transporter ATP-binding prote	97.23
3qf4_A		587	ABC transporter, ATP-binding protein; multidrug tr	97.18
2vf7_A		842	UVRA2, excinuclease ABC, subunit A.; DNA-binding p	97.07
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	97.03
3ux8_A		670	Excinuclease ABC, A subunit; UVRA, nucleotide exci	96.94
3g5u_A		1284	MCG1178, multidrug resistance protein 1A; P-glycop	96.91
2r6f_A		972	Excinuclease ABC subunit A; UVRA, nucleotide excis	96.89
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	96.8
2ygr_A		993	Uvrabc system protein A; hydrolase, nucleotide exc	96.75
2iw3_A		986	Elongation factor 3A; acetylation, ATP-binding, pr	96.74
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	96.53
2r6f_A		972	Excinuclease ABC subunit A; UVRA, nucleotide excis	96.51
3pih_A		916	Uvrabc system protein A; hydrolase, ABC ATPase, DN	96.45
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	96.34
3g5u_A		1284	MCG1178, multidrug resistance protein 1A; P-glycop	95.9
2vf7_A		842	UVRA2, excinuclease ABC, subunit A.; DNA-binding p	95.88
2ygr_A		993	Uvrabc system protein A; hydrolase, nucleotide exc	95.82
4f4c_A		1321	Multidrug resistance protein PGP-1; ABC transporte	95.43
2ehv_A		251	Hypothetical protein PH0186; KAIC, RECA ATPase, un	95.16
3j16_B		608	RLI1P; ribosome recycling, translation, eukarya, r	94.8
2obl_A		347	ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O	94.73
3ozx_A		538	RNAse L inhibitor; ATP binding cassette protein, h	94.51
1yqt_A		538	RNAse L inhibitor; ATP-binding cassette, ribosome	94.44
2npi_A		460	Protein CLP1; CLP1-PCF11 complex, ATP binding, ter	94.24
3bk7_A		607	ABC transporter ATP-binding protein; ABC ATPase, i	94.03
4aby_A		415	DNA repair protein RECN; hydrolase, double strand	93.58
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	92.41
3thx_A		934	DNA mismatch repair protein MSH2; ABC family ATPas	91.68
2dpy_A		438	FLII, flagellum-specific ATP synthase; beta barrel	91.07
1cr0_A		296	DNA primase/helicase; RECA-type protein fold, tran	89.76
2ff7_A		247	Alpha-hemolysin translocation ATP-binding protein	89.71
4ad8_A		517	DNA repair protein RECN; DNA binding protein, ATPa	89.5
2w0m_A		235	SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus	89.21
2o8b_B		1022	DNA mismatch repair protein MSH6; DNA damage respo	89.0
4a74_A		231	DNA repair and recombination protein RADA; hydrola	87.12
1tf7_A		525	KAIC; homohexamer, hexamer, circadian clock protei	86.88
3b5x_A		582	Lipid A export ATP-binding/permease protein MSBA;	84.24
3pih_A		916	Uvrabc system protein A; hydrolase, ABC ATPase, DN	84.09
3b60_A		582	Lipid A export ATP-binding/permease protein MSBA;	83.87
2v9p_A		305	Replication protein E1; AAA+ molecular motor, DNA	81.16
3arc_K		37	Photosystem II reaction center protein K; PSII, me	81.12

>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis}	Back alignment and structure

Probab=98.27  E-value=3.9e-07  Score=74.65  Aligned_cols=35  Identities=11%  Similarity=0.024  Sum_probs=34.3

Q ss_pred             hhhcCCChhHHHhhhceEEEeeCCEEEEEeccccc
Q psy863            9 IIVPIHVTSNTRDSIRLLATYFPGYAMICGFKLLG   43 (216)
Q Consensus         9 IilSTH~L~EaE~lcDrI~Il~~G~li~~Gs~~~L   43 (216)
                      ||++||++++++.+|||+++|++|++++.|+++++
T Consensus       201 vi~vtHdl~~~~~~~d~v~vl~~G~i~~~g~~~~~  235 (266)
T 4g1u_C          201 VCCVLHDLNLAALYADRIMLLAQGKLVACGTPEEV  235 (266)
T ss_dssp             EEEECSCHHHHHHHCSEEEEEETTEEEEEECHHHH
T ss_pred             EEEEEcCHHHHHHhCCEEEEEECCEEEEEcCHHHH
Confidence            99999999999999999999999999999999988

PyMOL of 4g1u

>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae}	Back alignment and structure

>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C	Back alignment and structure

>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A	Back alignment and structure

>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12	Back alignment and structure

>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124}	Back alignment and structure

>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J*	Back alignment and structure

>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A*	Back alignment and structure

>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius}	Back alignment and structure

>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima}	Back alignment and structure

>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12	Back alignment and structure

>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12	Back alignment and structure

>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii}	Back alignment and structure

>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A	Back alignment and structure

>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A*	Back alignment and structure

>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12	Back alignment and structure

>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A*	Back alignment and structure

>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C	Back alignment and structure

>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus}	Back alignment and structure

>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima}	Back alignment and structure

>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii}	Back alignment and structure

>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A*	Back alignment and structure

>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae}	Back alignment and structure

>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A*	Back alignment and structure

>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A*	Back alignment and structure

>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str}	Back alignment and structure

>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12	Back alignment and structure

>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens}	Back alignment and structure

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A*	Back alignment and structure

>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens}	Back alignment and structure

>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima}	Back alignment and structure

>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A*	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus}	Back alignment and structure

>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A*	Back alignment and structure

>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A	Back alignment and structure

>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima}	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A*	Back alignment and structure

>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A*	Back alignment and structure

>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans}	Back alignment and structure

>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae}	Back alignment and structure

>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A*	Back alignment and structure

>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus}	Back alignment and structure

>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus}	Back alignment and structure

>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae}	Back alignment and structure

>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B*	Back alignment and structure

>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans}	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A*	Back alignment and structure

>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium}	Back alignment and structure

>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A*	Back alignment and structure

>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A*	Back alignment and structure

>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans}	Back alignment and structure

>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2}	Back alignment and structure

>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B*	Back alignment and structure

>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A*	Back alignment and structure

>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A*	Back alignment and structure

>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae}	Back alignment and structure

>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima}	Back alignment and structure

>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A	Back alignment and structure

>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A*	Back alignment and structure

>3arc_K Photosystem II reaction center protein K; PSII, membrane-protein complex, transmembrane alpha-helix, E transport, photosynthesis; HET: OEX CLA PHO BCR PL9 SQD LMG UNL LMT HTG DGD LHG HEM; 1.90A {Thermosynechococcus vulcanus} PDB: 1izl_K* 1s5l_K* 2axt_K* 3bz1_K* 3bz2_K* 3kzi_K* 3prq_K* 3prr_K* 3a0b_K* 3a0h_K*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		216
d1vpla_		238	Putative ABC transporter TM0544 {Thermotoga mariti	98.99
d2onka1		240	Molybdate/tungstate import ATP-binding protein Wtp	98.77
d1g6ha_		254	MJ1267 {Archaeon Methanococcus jannaschii [TaxId:	98.73
d1b0ua_		258	ATP-binding subunit of the histidine permease {Sal	98.72
d1mv5a_		242	Multidrug resistance ABC transporter LmrA, C-termi	98.18
d1r0wa_		281	Cystic fibrosis transmembrane conductance regulato	97.95
d2pmka1		241	Haemolysin B ATP-binding protein {Escherichia coli	95.0
d2axtk1		37	Photosystem II reaction center protein K, PsbK {Th	86.28

>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]}	Back information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Putative ABC transporter TM0544
species: Thermotoga maritima [TaxId: 2336]

Probab=98.99  E-value=5.4e-11  Score=94.28  Aligned_cols=47  Identities=19%  Similarity=-0.020  Sum_probs=43.8

Q ss_pred             hhhhhHH--------hhhcCCChhHHHhhhceEEEeeCCEEEEEeccccccccccC
Q psy863            2 VLWCILL--------IIVPIHVTSNTRDSIRLLATYFPGYAMICGFKLLGNFEANG   49 (216)
Q Consensus         2 ~iw~lI~--------IilSTH~L~EaE~lcDrI~Il~~G~li~~Gs~~~L~k~~~~   49 (216)
                      ++|++|+        ||+|||+|+|++.+||||++|++|+++++|+++++ +++++
T Consensus       171 ~i~~~i~~~~~~g~tii~~tH~l~~~~~~~drv~vl~~G~iv~~g~~~el-~~~~~  225 (238)
T d1vpla_         171 EVRKILKQASQEGLTILVSSHNMLEVEFLCDRIALIHNGTIVETGTVEEL-KERYK  225 (238)
T ss_dssp             HHHHHHHHHHHTTCEEEEEECCHHHHTTTCSEEEEEETTEEEEEEEHHHH-HHHTT
T ss_pred             HHHHHHHHHHhcCCEEEEEeCCHHHHHHhCCEEEEEECCEEEEEcCHHHH-HhccC
Confidence            5788887        99999999999999999999999999999999999 87765

PyMOL of d1vpla_

>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]}	Back information, alignment and structure

>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]}	Back information, alignment and structure

>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]}	Back information, alignment and structure

>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]}	Back information, alignment and structure

>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2axtk1 f.23.36.1 (K:10-46) Photosystem II reaction center protein K, PsbK {Thermosynechococcus elongatus [TaxId: 146786]}	Back information, alignment and structure