Diaphorina citri psyllid: psy8674


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNRY
cHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccEEEEEEEEEECccccEEECcccccccCEEEEEEEEEEEEECccHHHHHcccccccccccccccccEEEEEHHHHHHHcccccccccccccCEEEEEEEEEEccEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHccccccccHHHHcEEEEECcccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHccccccccccEEEEEcccccccccccccccccccccccEEEEEEEEEEcccccEEECcccccccEEEEEEEEEEEEECcccHHHHHHcccccc
DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELP**********SEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELP************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
N-acetylgalactosaminyltransferase 7 Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified.confidentQ9R0C5
Probable N-acetylgalactosaminyltransferase 7 Probable glycopeptide transferase involved in O-linked oligosaccharide biosynthesis. Glycopeptide transferases catalyze the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide (By similarity). In contrast to other members of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on peptides that have been tested. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified.confidentO61397
N-acetylgalactosaminyltransferase 7 Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified.confidentQ5RFJ6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004653 [MF]polypeptide N-acetylgalactosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008376, GO:0008194
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016266 [BP]O-glycan processingprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0005975, GO:0044238, GO:0006493, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0009312 [BP]oligosaccharide biosynthetic processprobableGO:1901576, GO:0005975, GO:0044238, GO:0009311, GO:0016051, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0044723
GO:0018243 [BP]protein O-linked glycosylation via threonineprobableGO:0044237, GO:0044249, GO:0018210, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0005975, GO:0044238, GO:0006493, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D7I, chain A
Confidence level:very confident
Coverage over the Query: 207-429
View the alignment between query and template
View the model in PyMOL
Template: 2D7I, chain A
Confidence level:very confident
Coverage over the Query: 3-190
View the alignment between query and template
View the model in PyMOL