Psyllid ID: psy8674


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNRY
cHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHHHccccEEEEEEEEccccccccccccccccccccEEEEEEEEEEEccccEEEEcccccccEEEEEEEEEEEEEEEccHHHHHcccccccccccccccccEEEEEHHHHHHHcccccccccccccEEEEEEEEEEEccEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEEEccccHHHHHHHHccccccccHHHHcEEEEEEcccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHccccccccccEEEEEcccccccccccccccccccccccEEEEEEEEEEcccccEEEEcccccccEEEEEEEEEEEEEEcccHHHHHHHccccc
ccHHHHHHHHHHccccEEEEEcccccHHHHHHHHcHHHccccEEEEEccccHcccccHHHHHHHHHccccEEEEEEEEEEccccEEEEcccccccccEccEcEEEEEEEccccHHHHHcccccccccccccccccHEHEcHHHHHHHccccccccEEccccEEEEEEEEEcccEEEEEEccccEEEEcccccccccccccccccccHccccccccccccccHHHHHHHHHHHHHHcccEEEcHcccccccccccccHHHccccccccccccEEEEEEccHHHHHHHHHHHHHHHccHHHHHHHEEEEcccccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHcHHHccccEEEEEccccHcccccHHHHHHHHHccccEEEEEEEEEEccccEEEEccccccccEEccEccEEEEEEccccHHHHHccccccc
DLDKKLEDYIERFNGKVRLIRNTEreglirtrsrgakesrgEVIVFLDAHCEvglnwlppllapiysdrkimtvpvidgidyqtwefrsvyepdhhyrgifewgmlykenelpereakkrkynsepykspthagglfAMDRAFFLElggydpgllvwggenfELSFKIWMCggsiewvpcsrivslirpvfkadgklgnlepplepykegpgeggkayhlpeayraagdaslgeygmnmetsnhisfdrtipdlrmeeckywdypldlpkASVILVFHNEGFSSLMRTVHSIIKrtpaqyleeiilvddfsskadlDQKLEDYIQRFNGKVRLIRNTEreglirtrsrgakesrgEVIVFLDAHCEvglnwlppllapiysdrkimtvpvidgidyqtwefrsvyepdhhyrgifewgmlykenelpereakkrkynry
dldkkledyierfngkvrlirntereglirtrsrgakesrgeVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKkrkynsepykspthagGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFkadgklgnlepplePYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIqrfngkvrlirntereglirtrsrgakesrgeVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEwgmlykenelpereakkrkynry
DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKLGNlepplepykegpgeggkAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNRY
********YIERFNGKVRLIRNT*****************GEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYK************************AGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKL**********************************LGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLI**********RGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYK*****************
DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELP**********SEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELP************
DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPER**********
DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKLGNLEPPLEP*KEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKK******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKYNRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query439 2.2.26 [Sep-21-2011]
Q8MV48 591 N-acetylgalactosaminyltra yes N/A 0.569 0.423 0.616 2e-87
O61397 601 Probable N-acetylgalactos yes N/A 0.548 0.400 0.569 1e-75
Q9R0C5 657 N-acetylgalactosaminyltra yes N/A 0.560 0.374 0.509 7e-64
Q80VA0 657 N-acetylgalactosaminyltra yes N/A 0.560 0.374 0.509 2e-63
Q86SF2 657 N-acetylgalactosaminyltra yes N/A 0.560 0.374 0.501 5e-62
Q5RFJ6 657 N-acetylgalactosaminyltra yes N/A 0.560 0.374 0.501 5e-62
Q49A17 601 Polypeptide N-acetylgalac no N/A 0.496 0.362 0.475 2e-51
Q07537 559 Polypeptide N-acetylgalac no N/A 0.535 0.420 0.439 1e-49
Q29121 559 Polypeptide N-acetylgalac no N/A 0.535 0.420 0.439 2e-49
Q10472 559 Polypeptide N-acetylgalac no N/A 0.535 0.420 0.430 5e-49
>sp|Q8MV48|GALT7_DROME N-acetylgalactosaminyltransferase 7 OS=Drosophila melanogaster GN=GalNAc-T2 PE=2 SV=2 Back     alignment and function desciption
 Score =  323 bits (827), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 154/250 (61%), Positives = 190/250 (76%)

Query: 188 RPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISF 247
           R V K    LGN EP     + GPGE G+A+ L    +   DAS  EYGMN+  S+ IS 
Sbjct: 61  REVPKLVDGLGNFEPKDVKPRSGPGENGEAHSLSPDKKHMSDASEMEYGMNIACSDEISM 120

Query: 248 DRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILV 307
            R++ D R+EEC++WDYP DLP+ SVI+VFHNEGFS LMRTVHS+I R+P   L EIILV
Sbjct: 121 HRSVRDTRLEECRHWDYPFDLPRTSVIIVFHNEGFSVLMRTVHSVIDRSPTHMLHEIILV 180

Query: 308 DDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEV 367
           DDFS K +L  +L++Y+ +F G V++IRN EREGLIRTRSRGA E+ GEVIVFLDAHCEV
Sbjct: 181 DDFSDKENLRSQLDEYVLQFKGLVKVIRNKEREGLIRTRSRGAMEATGEVIVFLDAHCEV 240

Query: 368 GLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELP 427
             NWLPPLLAPIY DR +MTVP+IDGID++ +E+R VY  D+H+RGIFEWGMLYKENE+P
Sbjct: 241 NTNWLPPLLAPIYRDRTVMTVPIIDGIDHKNFEYRPVYGTDNHFRGIFEWGMLYKENEVP 300

Query: 428 EREAKKRKYN 437
            RE ++R +N
Sbjct: 301 RREQRRRAHN 310




Glycopeptide transferase involved in O-linked oligosaccharide biosynthesis, which catalyzes the transfer of an N-acetyl-D-galactosamine residue to an already glycosylated peptide. In contrast to other proteins of the family, it does not act as a peptide transferase that transfers GalNAc onto serine or threonine residue on the protein receptor, but instead requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Some peptide transferase activity is however not excluded, considering that its appropriate peptide substrate may remain unidentified. Prefers the monoglycosylated Muc5AC-3 as substrate.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: -
>sp|O61397|GALT7_CAEEL Probable N-acetylgalactosaminyltransferase 7 OS=Caenorhabditis elegans GN=gly-7 PE=2 SV=1 Back     alignment and function description
>sp|Q9R0C5|GALT7_RAT N-acetylgalactosaminyltransferase 7 OS=Rattus norvegicus GN=Galnt7 PE=2 SV=1 Back     alignment and function description
>sp|Q80VA0|GALT7_MOUSE N-acetylgalactosaminyltransferase 7 OS=Mus musculus GN=Galnt7 PE=2 SV=2 Back     alignment and function description
>sp|Q86SF2|GALT7_HUMAN N-acetylgalactosaminyltransferase 7 OS=Homo sapiens GN=GALNT7 PE=1 SV=1 Back     alignment and function description
>sp|Q5RFJ6|GALT7_PONAB N-acetylgalactosaminyltransferase 7 OS=Pongo abelii GN=GALNT7 PE=2 SV=1 Back     alignment and function description
>sp|Q49A17|GLTL6_HUMAN Polypeptide N-acetylgalactosaminyltransferase-like 6 OS=Homo sapiens GN=GALNTL6 PE=2 SV=2 Back     alignment and function description
>sp|Q07537|GALT1_BOVIN Polypeptide N-acetylgalactosaminyltransferase 1 OS=Bos taurus GN=GALNT1 PE=1 SV=1 Back     alignment and function description
>sp|Q29121|GALT1_PIG Polypeptide N-acetylgalactosaminyltransferase 1 OS=Sus scrofa GN=GALNT1 PE=2 SV=1 Back     alignment and function description
>sp|Q10472|GALT1_HUMAN Polypeptide N-acetylgalactosaminyltransferase 1 OS=Homo sapiens GN=GALNT1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query439
157106440 596 n-acetylgalactosaminyltransferase [Aedes 0.546 0.402 0.688 6e-93
193683588 588 PREDICTED: n-acetylgalactosaminyltransfe 0.562 0.420 0.673 3e-92
158289457 598 AGAP000656-PA [Anopheles gambiae str. PE 0.546 0.401 0.676 8e-92
321473823521 hypothetical protein DAPPUDRAFT_209135 [ 0.548 0.462 0.647 2e-90
91081797 583 PREDICTED: similar to n-acetylgalactosam 0.601 0.452 0.620 3e-90
312383497 874 hypothetical protein AND_03374 [Anophele 0.548 0.275 0.668 5e-90
195039904 591 GH12336 [Drosophila grimshawi] gi|193900 0.585 0.434 0.634 3e-89
383860243 581 PREDICTED: N-acetylgalactosaminyltransfe 0.562 0.425 0.646 1e-87
195400935 591 GJ15190 [Drosophila virilis] gi|19414172 0.585 0.434 0.626 2e-87
195447414 587 GK25256 [Drosophila willistoni] gi|19416 0.583 0.436 0.626 2e-87
>gi|157106440|ref|XP_001649323.1| n-acetylgalactosaminyltransferase [Aedes aegypti] gi|108879843|gb|EAT44068.1| AAEL004538-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  347 bits (890), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 166/241 (68%), Positives = 195/241 (80%)

Query: 197 LGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRM 256
           LGN EP     ++GPGEGGKAY LPE  +     +  EYGMN+  S+ IS DRTI D R+
Sbjct: 75  LGNFEPKEVDRRDGPGEGGKAYILPEDQQNRASDAEMEYGMNIVVSDTISLDRTIRDTRL 134

Query: 257 EECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADL 316
           EECK+WDYP +LP  SVI+VFHNEGFS LMRTVHS++ R+P   L EIILVDDFS K DL
Sbjct: 135 EECKHWDYPHNLPTTSVIIVFHNEGFSVLMRTVHSVLNRSPKHVLHEIILVDDFSDKEDL 194

Query: 317 DQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLL 376
            +KLE+YI+RF+GKV+LIRN EREGLIRTRSRGAKE+ GEVIV+LDAHCEV  NWLPPLL
Sbjct: 195 KEKLENYIERFDGKVKLIRNVEREGLIRTRSRGAKEATGEVIVYLDAHCEVNTNWLPPLL 254

Query: 377 APIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRKY 436
           APIY DR +MTVPVIDGID++T+E+R VY   HHYRGIFEWGMLYKENE+P RE K+RK+
Sbjct: 255 APIYRDRTVMTVPVIDGIDHKTFEYRPVYADGHHYRGIFEWGMLYKENEVPRREQKRRKH 314

Query: 437 N 437
           +
Sbjct: 315 D 315




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|193683588|ref|XP_001951150.1| PREDICTED: n-acetylgalactosaminyltransferase 7-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|158289457|ref|XP_311182.4| AGAP000656-PA [Anopheles gambiae str. PEST] gi|157018524|gb|EAA06901.4| AGAP000656-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|321473823|gb|EFX84789.1| hypothetical protein DAPPUDRAFT_209135 [Daphnia pulex] Back     alignment and taxonomy information
>gi|91081797|ref|XP_973938.1| PREDICTED: similar to n-acetylgalactosaminyltransferase [Tribolium castaneum] gi|270006291|gb|EFA02739.1| hypothetical protein TcasGA2_TC008465 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312383497|gb|EFR28562.1| hypothetical protein AND_03374 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|195039904|ref|XP_001990971.1| GH12336 [Drosophila grimshawi] gi|193900729|gb|EDV99595.1| GH12336 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|383860243|ref|XP_003705600.1| PREDICTED: N-acetylgalactosaminyltransferase 7-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195400935|ref|XP_002059071.1| GJ15190 [Drosophila virilis] gi|194141723|gb|EDW58140.1| GJ15190 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195447414|ref|XP_002071203.1| GK25256 [Drosophila willistoni] gi|194167288|gb|EDW82189.1| GK25256 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query439
FB|FBgn0030930591 GalNAc-T2 "UDP-N-acetyl-alpha- 0.453 0.336 0.695 2.7e-77
WB|WBGene00001632 601 gly-7 [Caenorhabditis elegans 0.482 0.352 0.596 2.4e-69
ZFIN|ZDB-GENE-050522-284 652 galnt7 "UDP-N-acetyl-alpha-D-g 0.487 0.328 0.540 1.5e-58
RGD|620362 657 Galnt7 "UDP-N-acetyl-alpha-D-g 0.487 0.325 0.527 6.6e-58
UNIPROTKB|Q9R0C5 657 Galnt7 "N-acetylgalactosaminyl 0.487 0.325 0.527 6.6e-58
MGI|MGI:1349449 657 Galnt7 "UDP-N-acetyl-alpha-D-g 0.487 0.325 0.527 8.4e-58
UNIPROTKB|F1Q3F3 657 GALNT7 "Uncharacterized protei 0.487 0.325 0.527 1.1e-57
UNIPROTKB|F1N4Q3 652 GALNT7 "Uncharacterized protei 0.487 0.328 0.532 1.4e-57
UNIPROTKB|F1RIZ9 615 GALNT7 "Uncharacterized protei 0.487 0.347 0.522 2.8e-57
UNIPROTKB|F1NPU9 613 GALNT7 "Uncharacterized protei 0.498 0.357 0.504 4.6e-57
FB|FBgn0030930 GalNAc-T2 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 778 (278.9 bits), Expect = 2.7e-77, P = 2.7e-77
 Identities = 139/200 (69%), Positives = 168/200 (84%)

Query:     1 DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPP 60
             +L  +L++Y+ +F G V++IRN EREGLIRTRSRGA E+ GEVIVFLDAHCEV  NWLPP
Sbjct:   188 NLRSQLDEYVLQFKGLVKVIRNKEREGLIRTRSRGAMEATGEVIVFLDAHCEVNTNWLPP 247

Query:    61 LLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKR 120
             LLAPIY DR +MTVP+IDGID++ +E+R VY  D+H+RGIFEWGMLYKENE+P RE ++R
Sbjct:   248 LLAPIYRDRTVMTVPIIDGIDHKNFEYRPVYGTDNHFRGIFEWGMLYKENEVPRREQRRR 307

Query:   121 KYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPC 180
              +NSEPY+SPTHAGGLFA++R +FLELG YDPGLLVWGGENFELSFKIW CGGSIEWVPC
Sbjct:   308 AHNSEPYRSPTHAGGLFAINREYFLELGAYDPGLLVWGGENFELSFKIWQCGGSIEWVPC 367

Query:   181 SRIVSLIRPVFKAD-GKLGN 199
             SR+  + R     + GKL +
Sbjct:   368 SRVGHVYRGFMPYNFGKLAS 387


GO:0004653 "polypeptide N-acetylgalactosaminyltransferase activity" evidence=ISS;IDA;NAS
GO:0009312 "oligosaccharide biosynthetic process" evidence=IDA
GO:0005795 "Golgi stack" evidence=NAS
WB|WBGene00001632 gly-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050522-284 galnt7 "UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|620362 Galnt7 "UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 7 (GalNAc-T7)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9R0C5 Galnt7 "N-acetylgalactosaminyltransferase 7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1349449 Galnt7 "UDP-N-acetyl-alpha-D-galactosamine: polypeptide N-acetylgalactosaminyltransferase 7" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3F3 GALNT7 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4Q3 GALNT7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIZ9 GALNT7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPU9 GALNT7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O61397GALT7_CAEEL2, ., 4, ., 1, ., -0.56910.54890.4009yesN/A
Q86SF2GALT7_HUMAN2, ., 4, ., 1, ., -0.50190.56030.3744yesN/A
Q80VA0GALT7_MOUSE2, ., 4, ., 1, ., -0.50980.56030.3744yesN/A
Q9R0C5GALT7_RAT2, ., 4, ., 1, ., -0.50980.56030.3744yesN/A
Q5RFJ6GALT7_PONAB2, ., 4, ., 1, ., -0.50190.56030.3744yesN/A
Q8MV48GALT7_DROME2, ., 4, ., 1, ., -0.6160.56940.4230yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.1LOW CONFIDENCE prediction!
4th Layer2.4.1.80LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
cd02510299 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo 3e-96
cd02510 299 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the fo 1e-76
pfam00535168 pfam00535, Glycos_transf_2, Glycosyl transferase f 1e-22
pfam00535168 pfam00535, Glycos_transf_2, Glycosyl transferase f 3e-13
cd00761156 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase 2e-12
cd02525249 cd02525, Succinoglycan_BP_ExoA, ExoA is involved i 1e-09
COG0463 291 COG0463, WcaA, Glycosyltransferases involved in ce 2e-08
COG1215 439 COG1215, COG1215, Glycosyltransferases, probably i 2e-08
cd06423180 cd06423, CESA_like, CESA_like is the cellulose syn 9e-08
TIGR03965467 TIGR03965, mycofact_glyco, mycofactocin system gly 3e-07
cd04186166 cd04186, GT_2_like_c, Subfamily of Glycosyltransfe 6e-07
cd04192229 cd04192, GT_2_like_e, Subfamily of Glycosyltransfe 9e-07
TIGR03965 467 TIGR03965, mycofact_glyco, mycofactocin system gly 2e-06
pfam10111278 pfam10111, Glyco_tranf_2_2, Glycosyltransferase li 2e-06
pfam0270978 pfam02709, Glyco_transf_7C, N-terminal domain of g 4e-06
pfam13641229 pfam13641, Glyco_tranf_2_3, Glycosyltransferase li 4e-06
cd04179185 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_l 7e-06
cd00761156 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase 1e-05
COG1216 305 COG1216, COG1216, Predicted glycosyltransferases [ 1e-05
COG1216305 COG1216, COG1216, Predicted glycosyltransferases [ 2e-05
cd04188211 cd04188, DPG_synthase, DPG_synthase is involved in 2e-05
cd02525249 cd02525, Succinoglycan_BP_ExoA, ExoA is involved i 3e-05
COG1215439 COG1215, COG1215, Glycosyltransferases, probably i 3e-04
cd04186166 cd04186, GT_2_like_c, Subfamily of Glycosyltransfe 3e-04
pfam10111 278 pfam10111, Glyco_tranf_2_2, Glycosyltransferase li 5e-04
cd06442224 cd06442, DPM1_like, DPM1_like represents putative 5e-04
cd04184202 cd04184, GT2_RfbC_Mx_like, Myxococcus xanthus RfbC 0.003
cd06439251 cd06439, CESA_like_1, CESA_like_1 is a member of t 0.003
cd04187181 cd04187, DPM1_like_bac, Bacterial DPM1_like enzyme 0.004
>gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
 Score =  290 bits (745), Expect = 3e-96
 Identities = 96/183 (52%), Positives = 130/183 (71%), Gaps = 4/183 (2%)

Query: 1   DLDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPP 60
           +L   LE+Y +++  KV+++R  +REGLIR R  GA+ + G+V+VFLD+HCEV + WL P
Sbjct: 44  ELKLLLEEYYKKYLPKVKVLRLKKREGLIRARIAGARAATGDVLVFLDSHCEVNVGWLEP 103

Query: 61  LLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKR 120
           LLA I  +RK +  P+ID ID  T+E+R         RG F+W + +K   LPE E ++R
Sbjct: 104 LLARIAENRKTVVCPIIDVIDADTFEYRGSSGDA---RGGFDWSLHFKWLPLPEEE-RRR 159

Query: 121 KYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPC 180
           +  + P +SPT AGGLFA+DR +FLELGGYD G+ +WGGEN ELSFK+W CGGSIE VPC
Sbjct: 160 ESPTAPIRSPTMAGGLFAIDREWFLELGGYDEGMDIWGGENLELSFKVWQCGGSIEIVPC 219

Query: 181 SRI 183
           SR+
Sbjct: 220 SRV 222


UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferases (pp-GalNAc-T) initiate the formation of mucin-type, O-linked glycans by catalyzing the transfer of alpha-N-acetylgalactosamine (GalNAc) from UDP-GalNAc to hydroxyl groups of Ser or Thr residues of core proteins to form the Tn antigen (GalNAc-a-1-O-Ser/Thr). These enzymes are type II membrane proteins with a GT-A type catalytic domain and a lectin domain located on the lumen side of the Golgi apparatus. In human, there are 15 isozymes of pp-GalNAc-Ts, representing the largest of all glycosyltransferase families. Each isozyme has unique but partially redundant substrate specificity for glycosylation sites on acceptor proteins. Length = 299

>gnl|CDD|133004 cd02510, pp-GalNAc-T, pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>gnl|CDD|215980 pfam00535, Glycos_transf_2, Glycosyl transferase family 2 Back     alignment and domain information
>gnl|CDD|215980 pfam00535, Glycos_transf_2, Glycosyl transferase family 2 Back     alignment and domain information
>gnl|CDD|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>gnl|CDD|133016 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>gnl|CDD|223539 COG0463, WcaA, Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133045 cd06423, CESA_like, CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>gnl|CDD|234419 TIGR03965, mycofact_glyco, mycofactocin system glycosyltransferase Back     alignment and domain information
>gnl|CDD|133029 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|133035 cd04192, GT_2_like_e, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|234419 TIGR03965, mycofact_glyco, mycofactocin system glycosyltransferase Back     alignment and domain information
>gnl|CDD|220577 pfam10111, Glyco_tranf_2_2, Glycosyltransferase like family 2 Back     alignment and domain information
>gnl|CDD|217196 pfam02709, Glyco_transf_7C, N-terminal domain of galactosyltransferase Back     alignment and domain information
>gnl|CDD|222281 pfam13641, Glyco_tranf_2_3, Glycosyltransferase like family 2 Back     alignment and domain information
>gnl|CDD|133022 cd04179, DPM_DPG-synthase_like, DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>gnl|CDD|132997 cd00761, Glyco_tranf_GTA_type, Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>gnl|CDD|224137 COG1216, COG1216, Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224137 COG1216, COG1216, Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|133031 cd04188, DPG_synthase, DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>gnl|CDD|133016 cd02525, Succinoglycan_BP_ExoA, ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>gnl|CDD|224136 COG1215, COG1215, Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|133029 cd04186, GT_2_like_c, Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>gnl|CDD|220577 pfam10111, Glyco_tranf_2_2, Glycosyltransferase like family 2 Back     alignment and domain information
>gnl|CDD|133062 cd06442, DPM1_like, DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>gnl|CDD|133027 cd04184, GT2_RfbC_Mx_like, Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>gnl|CDD|133061 cd06439, CESA_like_1, CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>gnl|CDD|133030 cd04187, DPM1_like_bac, Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 439
KOG3737|consensus 603 100.0
cd02510299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 99.97
KOG3738|consensus 559 99.96
KOG3736|consensus 578 99.96
KOG3737|consensus603 99.96
KOG3736|consensus578 99.95
KOG3738|consensus559 99.94
cd02510 299 pp-GalNAc-T pp-GalNAc-T initiates the formation of 99.91
COG1216305 Predicted glycosyltransferases [General function p 99.89
PRK10073 328 putative glycosyl transferase; Provisional 99.87
TIGR01556281 rhamnosyltran L-rhamnosyltransferase. Rhamnolipids 99.85
PF10111281 Glyco_tranf_2_2: Glycosyltransferase like family 2 99.85
cd02520196 Glucosylceramide_synthase Glucosylceramide synthas 99.83
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 99.83
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 99.83
PRK10018 279 putative glycosyl transferase; Provisional 99.82
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit 99.82
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot 99.82
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 99.82
TIGR03111 439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR0 99.82
cd04184202 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like prot 99.81
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Famil 99.81
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulo 99.81
TIGR03469 384 HonB hopene-associated glycosyltransferase HpnB. T 99.81
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl tr 99.81
PLN02726243 dolichyl-phosphate beta-D-mannosyltransferase 99.8
PRK11204 420 N-glycosyltransferase; Provisional 99.8
cd04195201 GT2_AmsE_like GT2_AmsE_like is involved in exopoly 99.8
PF13641228 Glyco_tranf_2_3: Glycosyltransferase like family 2 99.8
PRK14583 444 hmsR N-glycosyltransferase; Provisional 99.8
cd06435236 CESA_NdvC_like NdvC_like proteins in this family a 99.8
TIGR03472 373 HpnI hopanoid biosynthesis associated glycosyl tra 99.79
cd02520196 Glucosylceramide_synthase Glucosylceramide synthas 99.79
cd06913219 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltran 99.79
PRK10063248 putative glycosyl transferase; Provisional 99.79
cd06437232 CESA_CaSu_A2 Cellulose synthase catalytic subunit 99.79
cd06913219 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltran 99.79
cd06420182 GT2_Chondriotin_Pol_N N-terminal domain of Chondro 99.79
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the 99.79
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 99.79
cd06442224 DPM1_like DPM1_like represents putative enzymes si 99.78
cd06435236 CESA_NdvC_like NdvC_like proteins in this family a 99.78
PTZ00260333 dolichyl-phosphate beta-glucosyltransferase; Provi 99.78
cd04188211 DPG_synthase DPG_synthase is involved in protein N 99.77
PRK10714 325 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi 99.77
PRK11204420 N-glycosyltransferase; Provisional 99.76
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-ant 99.76
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Famil 99.76
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the bios 99.76
PRK13915 306 putative glucosyl-3-phosphoglycerate synthase; Pro 99.74
cd02525249 Succinoglycan_BP_ExoA ExoA is involved in the bios 99.74
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Famil 99.74
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 99.74
cd04185202 GT_2_like_b Subfamily of Glycosyltransferase Famil 99.74
cd06423180 CESA_like CESA_like is the cellulose synthase supe 99.74
PRK14583444 hmsR N-glycosyltransferase; Provisional 99.74
cd04192229 GT_2_like_e Subfamily of Glycosyltransferase Famil 99.73
cd06421234 CESA_CelA_like CESA_CelA_like are involved in the 99.73
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerizati 99.73
cd06436191 GlcNAc-1-P_transferase N-acetyl-glucosamine transf 99.73
cd06427241 CESA_like_2 CESA_like_2 is a member of the cellulo 99.73
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 99.72
cd06438183 EpsO_like EpsO protein participates in the methano 99.72
KOG2978|consensus238 99.71
cd06420182 GT2_Chondriotin_Pol_N N-terminal domain of Chondro 99.71
cd06433202 GT_2_WfgS_like WfgS and WfeV are involved in O-ant 99.71
PF13641228 Glyco_tranf_2_3: Glycosyltransferase like family 2 99.71
cd06442224 DPM1_like DPM1_like represents putative enzymes si 99.71
cd02511229 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 99.7
cd02522221 GT_2_like_a GT_2_like_a represents a glycosyltrans 99.69
TIGR03111439 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR0 99.69
PRK11498 852 bcsA cellulose synthase catalytic subunit; Provisi 99.68
TIGR03469384 HonB hopene-associated glycosyltransferase HpnB. T 99.67
TIGR03030 713 CelA cellulose synthase catalytic subunit (UDP-for 99.67
PLN02726243 dolichyl-phosphate beta-D-mannosyltransferase 99.67
cd04186166 GT_2_like_c Subfamily of Glycosyltransferase Famil 99.66
TIGR03472373 HpnI hopanoid biosynthesis associated glycosyl tra 99.66
COG1215 439 Glycosyltransferases, probably involved in cell wa 99.65
COG0463 291 WcaA Glycosyltransferases involved in cell wall bi 99.64
cd02522221 GT_2_like_a GT_2_like_a represents a glycosyltrans 99.63
COG1216 305 Predicted glycosyltransferases [General function p 99.62
PRK10018279 putative glycosyl transferase; Provisional 99.62
PRK11498 852 bcsA cellulose synthase catalytic subunit; Provisi 99.62
cd04196214 GT_2_like_d Subfamily of Glycosyltransferase Famil 99.62
cd02526237 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl tr 99.61
cd06434235 GT2_HAS Hyaluronan synthases catalyze polymerizati 99.61
cd06439251 CESA_like_1 CESA_like_1 is a member of the cellulo 99.6
TIGR03030 713 CelA cellulose synthase catalytic subunit (UDP-for 99.58
cd04179185 DPM_DPG-synthase_like DPM_DPG-synthase_like is a m 99.54
PRK10073328 putative glycosyl transferase; Provisional 99.54
PRK10063248 putative glycosyl transferase; Provisional 99.54
cd04190244 Chitin_synth_C C-terminal domain of Chitin Synthas 99.54
TIGR01556 281 rhamnosyltran L-rhamnosyltransferase. Rhamnolipids 99.53
cd04188211 DPG_synthase DPG_synthase is involved in protein N 99.53
PF10111 281 Glyco_tranf_2_2: Glycosyltransferase like family 2 99.5
cd04191254 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elon 99.49
PRK14716 504 bacteriophage N4 adsorption protein B; Provisional 99.48
COG1215439 Glycosyltransferases, probably involved in cell wa 99.46
cd04187181 DPM1_like_bac Bacterial DPM1_like enzymes are rela 99.45
PF13712217 Glyco_tranf_2_5: Glycosyltransferase like family; 99.45
PF00535169 Glycos_transf_2: Glycosyl transferase family 2; In 99.44
KOG2977|consensus323 99.43
cd06423180 CESA_like CESA_like is the cellulose synthase supe 99.43
cd04190244 Chitin_synth_C C-terminal domain of Chitin Synthas 99.41
PF13632193 Glyco_trans_2_3: Glycosyl transferase family group 99.38
PRK11234 727 nfrB bacteriophage N4 adsorption protein B; Provis 99.38
cd04191254 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elon 99.37
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 99.36
PRK05454 691 glucosyltransferase MdoH; Provisional 99.34
PF13506175 Glyco_transf_21: Glycosyl transferase family 21 99.29
PF0270978 Glyco_transf_7C: N-terminal domain of galactosyltr 99.24
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in 99.24
PRK14716504 bacteriophage N4 adsorption protein B; Provisional 99.23
cd06438183 EpsO_like EpsO protein participates in the methano 99.2
PRK15489 703 nfrB bacteriophage N4 adsorption protein B; Provis 99.19
cd00761156 Glyco_tranf_GTA_type Glycosyltransferase family A 99.12
cd06436191 GlcNAc-1-P_transferase N-acetyl-glucosamine transf 99.05
PTZ00260333 dolichyl-phosphate beta-glucosyltransferase; Provi 99.03
cd02514 334 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an es 98.99
PRK11234 727 nfrB bacteriophage N4 adsorption protein B; Provis 98.96
PRK05454691 glucosyltransferase MdoH; Provisional 98.91
PRK15489 703 nfrB bacteriophage N4 adsorption protein B; Provis 98.77
PRK13915306 putative glucosyl-3-phosphoglycerate synthase; Pro 98.76
PRK10714325 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabi 98.74
KOG3588|consensus494 98.69
KOG2547|consensus 431 98.64
COG4092346 Predicted glycosyltransferase involved in capsule 98.53
KOG2978|consensus238 98.51
PF05679499 CHGN: Chondroitin N-acetylgalactosaminyltransferas 98.48
cd02511229 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 98.31
PF13712217 Glyco_tranf_2_5: Glycosyltransferase like family; 98.24
PF11397343 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IP 98.21
KOG3916|consensus372 98.0
PF1370497 Glyco_tranf_2_4: Glycosyl transferase family 2 97.89
PF03142 527 Chitin_synth_2: Chitin synthase; InterPro: IPR0048 97.85
PLN02893734 Cellulose synthase-like protein 97.79
PF03452269 Anp1: Anp1; InterPro: IPR005109 The members of thi 97.72
cd02514334 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an es 97.64
PF13506175 Glyco_transf_21: Glycosyl transferase family 21 97.45
PF06306347 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase ( 97.44
PF03071 434 GNT-I: GNT-I family; InterPro: IPR004139 The biosy 97.44
COG4092 346 Predicted glycosyltransferase involved in capsule 97.18
PF13896317 Glyco_transf_49: Glycosyl-transferase for dystrogl 97.15
COG0463291 WcaA Glycosyltransferases involved in cell wall bi 97.11
KOG2547|consensus431 96.99
COG2943 736 MdoH Membrane glycosyltransferase [Cell envelope b 96.96
PF03142527 Chitin_synth_2: Chitin synthase; InterPro: IPR0048 96.9
PF09488 381 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthas 96.83
PF11316234 Rhamno_transf: Putative rhamnosyl transferase ; In 96.54
KOG3917|consensus310 96.31
TIGR02460 381 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase 96.2
PRK14503 393 mannosyl-3-phosphoglycerate synthase; Provisional 96.17
PF05679499 CHGN: Chondroitin N-acetylgalactosaminyltransferas 96.04
KOG2977|consensus323 95.48
PF11735241 CAP59_mtransfer: Cryptococcal mannosyltransferase 95.41
PF09258247 Glyco_transf_64: Glycosyl transferase family 64 do 95.35
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 95.01
cd00218223 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) 94.72
PRK14502 694 bifunctional mannosyl-3-phosphoglycerate synthase/ 94.56
KOG1476|consensus330 94.52
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 94.52
KOG2571|consensus862 94.49
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 94.4
PF03214 348 RGP: Reversibly glycosylated polypeptide; InterPro 94.37
KOG3588|consensus494 94.32
COG1209 286 RfbA dTDP-glucose pyrophosphorylase [Cell envelope 93.92
PF03452269 Anp1: Anp1; InterPro: IPR005109 The members of thi 93.91
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 93.8
PLN02458346 transferase, transferring glycosyl groups 93.68
COG1213239 Predicted sugar nucleotidyltransferases [Cell enve 93.63
PRK15480 292 glucose-1-phosphate thymidylyltransferase RfbA; Pr 93.4
PF01762195 Galactosyl_T: Galactosyltransferase; InterPro: IPR 93.09
PLN02195 977 cellulose synthase A 93.06
PRK00317193 mobA molybdopterin-guanine dinucleotide biosynthes 93.06
cd04181217 NTP_transferase NTP_transferases catalyze the tran 92.97
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 92.85
TIGR03202190 pucB xanthine dehydrogenase accessory protein pucB 92.84
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 92.45
cd06425233 M1P_guanylylT_B_like_N N-terminal domain of the M1 92.38
PF12804160 NTP_transf_3: MobA-like NTP transferase domain; PD 92.38
TIGR01207 286 rmlA glucose-1-phosphate thymidylyltransferase, sh 92.28
PLN02189 1040 cellulose synthase 92.13
cd02503181 MobA MobA catalyzes the formation of molybdopterin 92.0
PLN02893 734 Cellulose synthase-like protein 91.87
PF13632 193 Glyco_trans_2_3: Glycosyl transferase family group 91.32
PLN02189 1040 cellulose synthase 91.21
PF13733136 Glyco_transf_7N: N-terminal region of glycosyl tra 91.21
cd06431280 GT8_LARGE_C LARGE catalytic domain has closest hom 91.16
cd06422221 NTP_transferase_like_1 NTP_transferase_like_1 is a 90.98
PF01697285 Glyco_transf_92: Glycosyltransferase family 92; In 90.93
PRK13368238 3-deoxy-manno-octulosonate cytidylyltransferase; P 90.74
COG1211230 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synt 90.64
PF04666297 Glyco_transf_54: N-Acetylglucosaminyltransferase-I 90.63
cd06428257 M1P_guanylylT_A_like_N N-terminal domain of M1P_gu 90.39
PLN02917293 CMP-KDO synthetase 90.11
PF11397 343 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IP 89.91
TIGR03552195 F420_cofC 2-phospho-L-lactate guanylyltransferase 89.84
cd04189236 G1P_TT_long G1P_TT_long represents the long form o 89.82
cd06915223 NTP_transferase_WcbM_like WcbM_like is a subfamily 89.82
cd02538240 G1P_TT_short G1P_TT_short is the short form of glu 89.81
KOG1413|consensus 411 89.7
COG1208358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 89.65
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 89.52
cd00899219 b4GalT Beta-4-Galactosyltransferase is involved in 89.42
PLN02248 1135 cellulose synthase-like protein 89.32
PRK13385230 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 89.09
cd02509274 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransf 88.96
cd02518233 GT2_SpsF SpsF is a glycosyltrnasferase implicated 88.78
PRK00155227 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 88.59
cd04182186 GT_2_like_f GT_2_like_f is a subfamily of the glyc 88.55
PRK14353 446 glmU bifunctional N-acetylglucosamine-1-phosphate 88.54
PLN03180 346 reversibly glycosylated polypeptide; Provisional 88.47
cd00505246 Glyco_transf_8 Members of glycosyltransferase fami 88.38
COG2068199 Uncharacterized MobA-related protein [General func 88.3
PRK09382 378 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosp 88.28
PLN02917293 CMP-KDO synthetase 87.53
cd04198214 eIF-2B_gamma_N The N-terminal domain of gamma subu 87.53
PLN02190756 cellulose synthase-like protein 87.39
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 87.15
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 86.81
PRK05450245 3-deoxy-manno-octulosonate cytidylyltransferase; P 86.46
cd06426220 NTP_transferase_like_2 NTP_trnasferase_like_2 is a 86.26
PLN03153537 hypothetical protein; Provisional 86.21
PRK02726200 molybdopterin-guanine dinucleotide biosynthesis pr 86.13
COG1208 358 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylas 85.98
PF03214348 RGP: Reversibly glycosylated polypeptide; InterPro 85.9
TIGR03310188 matur_ygfJ molybdenum hydroxylase accessory protei 85.58
cd02513223 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N- 85.29
PRK14352 482 glmU bifunctional N-acetylglucosamine-1-phosphate 85.2
PF00483248 NTP_transferase: Nucleotidyl transferase This Pros 85.17
TIGR02665186 molyb_mobA molybdopterin-guanine dinucleotide bios 85.1
KOG3916|consensus372 85.08
COG2943 736 MdoH Membrane glycosyltransferase [Cell envelope b 85.01
cd02540229 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU 85.0
cd02516218 CDP-ME_synthetase CDP-ME synthetase is involved in 84.88
PRK14355 459 glmU bifunctional N-acetylglucosamine-1-phosphate 84.52
PLN02190 756 cellulose synthase-like protein 84.44
TIGR03584222 PseF pseudaminic acid CMP-transferase. The sequenc 84.37
cd04183231 GT2_BcE_like GT2_BcbE_like is likely involved in t 83.73
PF02434252 Fringe: Fringe-like; InterPro: IPR003378 The Notch 83.7
cd04194248 GT8_A4GalT_like A4GalT_like proteins catalyze the 83.57
PRK14360 450 glmU bifunctional N-acetylglucosamine-1-phosphate 83.12
cd02517239 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes th 83.07
TIGR01173 451 glmU UDP-N-acetylglucosamine diphosphorylase/gluco 83.07
PF13896 317 Glyco_transf_49: Glycosyl-transferase for dystrogl 83.05
cd02508200 ADP_Glucose_PP ADP-glucose pyrophosphorylase is in 82.94
TIGR00466238 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransfe 82.91
cd02503181 MobA MobA catalyzes the formation of molybdopterin 82.89
TIGR00453217 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyl 82.68
KOG1022|consensus691 82.37
TIGR00454183 conserved hypothetical protein TIGR00454. At this 81.71
PF03552 720 Cellulose_synt: Cellulose synthase; InterPro: IPR0 81.55
PLN02638 1079 cellulose synthase A (UDP-forming), catalytic subu 81.28
PRK15171 334 lipopolysaccharide 1,3-galactosyltransferase; Prov 81.24
cd02541267 UGPase_prokaryotic Prokaryotic UGPase catalyses th 81.0
TIGR01105297 galF UTP-glucose-1-phosphate uridylyltransferase, 80.94
cd02523229 PC_cytidylyltransferase Phosphocholine cytidylyltr 80.69
PLN02728252 2-C-methyl-D-erythritol 4-phosphate cytidylyltrans 80.33
>KOG3737|consensus Back     alignment and domain information
Probab=100.00  E-value=2.2e-35  Score=267.11  Aligned_cols=243  Identities=59%  Similarity=1.011  Sum_probs=230.6

Q ss_pred             cCCCCCCCCCC-CCCCCCCCCccccCcHhHHhhhhhhhhhcccceecccccCCCCCCCcccccccccccCCCCCCceEEE
Q psy8674         196 KLGNLEPPLEP-YKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMETSNHISFDRTIPDLRMEECKYWDYPLDLPKASVI  274 (439)
Q Consensus       196 ~~~~~~~~~~~-~~~~~~~~g~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~vsii  274 (439)
                      .++++.++.|. ...++|..|+|..+.++...+.++..+++|+|.+.||.++++|.++|.|+..|+...||..+|+.|||
T Consensus        81 ~LGNfEPKepe~P~~gPGE~gkp~~l~pe~k~a~~AsekEfGfN~~~SDmISm~R~v~D~R~EECkhWdYpe~Lpt~SVv  160 (603)
T KOG3737|consen   81 ILGNFEPKEPEPPVGGPGEKGKPLVLGPEFKQAIQASEKEFGFNMVASDMISMDRNVNDLRQEECKHWDYPENLPTSSVV  160 (603)
T ss_pred             ccCCCCCCCCCCCCCCCCcCCcccccChhHHHHHHHHHHhhCcceeehhhhhcccCccccCHhhccccCCcccCCcceEE
Confidence            38999998864 55689999999999888888889999999999999999999999999999999999999999999999


Q ss_pred             EEecCCChhHHHHHHHHHHhcCCcCCcceEEEEeCCCChhhHHHHHHHHHHHcCCcEEEEEcCCCCCHHHHHHHHHhhcC
Q psy8674         275 LVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESR  354 (439)
Q Consensus       275 ip~~n~~~~~l~~~l~sl~~q~~~~~~~eiivvdd~s~d~t~~~~~~~~~~~~~~~v~~i~~~~~~g~~~a~n~g~~~a~  354 (439)
                      |+.+|+.|..|.+++.|++..+++.+..|||+|||-|+.+.+.+.+++|...+.+.|++++++++.|...|+-.|+..|+
T Consensus       161 iVFHNEGws~LmRTVHSVi~RsP~~~l~eivlvDDfSdKehLkekLDeYv~~fnGlVkV~Rne~REGLI~aRSiGA~~at  240 (603)
T KOG3737|consen  161 IVFHNEGWSTLMRTVHSVIKRSPRKYLAEIVLVDDFSDKEHLKEKLDEYVKLFNGLVKVFRNERREGLIQARSIGAQKAT  240 (603)
T ss_pred             EEEecCccHHHHHHHHHHHhcCcHHhhheEEEeccCCccHHHHHHHHHHHHHhcCEEEEEecchhhhhhhhhccchhhcc
Confidence            99999999999999999999998888889999999999999999999999999989999999999999999999999999


Q ss_pred             CCEEEEEcCCCccCCCChHHHHHhhhcCCCEEEEeeeeeecCCCceEEeecCCCC-CceeeeeccceeEeecCCHHHHhh
Q psy8674         355 GEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDH-HYRGIFEWGMLYKENELPEREAKK  433 (439)
Q Consensus       355 ~d~i~~ld~D~~~~~~~l~~l~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~-~~~g~~~w~~~~~~~~~~~~~~~~  433 (439)
                      |+.++|||+.|++..+|+..|++++.++..++.+|.||.||.++|+|.+.||+.. +++|.|+|+|.+++.+++.+|..+
T Consensus       241 GeV~ifLDAHCEVntNWlpPLlAPI~rdRtvmTVP~IDgId~n~~EyrpvyG~dn~h~rGifeWgmLyKe~~~t~rE~r~  320 (603)
T KOG3737|consen  241 GEVLIFLDAHCEVNTNWLPPLLAPISRDRTVMTVPLIDGIDGNTYEYRPVYGGDNDHARGIFEWGMLYKEVPLTPREKRL  320 (603)
T ss_pred             ccEEEEEecceeeecccccccccccccCceEEEEeeeeeecCCceEEeeccCCcchhhcchhhhhheeccCCCCHHHHHh
Confidence            9999999999999999999999999999999999999999999999999999866 789999999999999999999998


Q ss_pred             ccCCC
Q psy8674         434 RKYNR  438 (439)
Q Consensus       434 ~~~~~  438 (439)
                      ||-++
T Consensus       321 Rkhns  325 (603)
T KOG3737|consen  321 RKHNS  325 (603)
T ss_pred             hhccC
Confidence            87654



>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>KOG3738|consensus Back     alignment and domain information
>KOG3736|consensus Back     alignment and domain information
>KOG3737|consensus Back     alignment and domain information
>KOG3736|consensus Back     alignment and domain information
>KOG3738|consensus Back     alignment and domain information
>cd02510 pp-GalNAc-T pp-GalNAc-T initiates the formation of mucin-type O-linked glycans Back     alignment and domain information
>COG1216 Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>PRK10073 putative glycosyl transferase; Provisional Back     alignment and domain information
>TIGR01556 rhamnosyltran L-rhamnosyltransferase Back     alignment and domain information
>PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ] Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK10018 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 Back     alignment and domain information
>cd04184 GT2_RfbC_Mx_like Myxococcus xanthus RfbC like proteins are required for O-antigen biosynthesis Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>PRK11204 N-glycosyltransferase; Provisional Back     alignment and domain information
>cd04195 GT2_AmsE_like GT2_AmsE_like is involved in exopolysaccharide amylovora biosynthesis Back     alignment and domain information
>PF13641 Glyco_tranf_2_3: Glycosyltransferase like family 2; PDB: 4FIY_B 4FIX_A Back     alignment and domain information
>PRK14583 hmsR N-glycosyltransferase; Provisional Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI Back     alignment and domain information
>cd02520 Glucosylceramide_synthase Glucosylceramide synthase catalyzes the first glycosylation step of glycosphingolipid synthesis Back     alignment and domain information
>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>PRK10063 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd06437 CESA_CaSu_A2 Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex Back     alignment and domain information
>cd06913 beta3GnTL1_like Beta 1, 3-N-acetylglucosaminyltransferase is essential for the formation of poly-N-acetyllactosamine Back     alignment and domain information
>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>cd06435 CESA_NdvC_like NdvC_like proteins in this family are putative bacterial beta-(1,6)-glucosyltransferase Back     alignment and domain information
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>PRK11204 N-glycosyltransferase; Provisional Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>PRK13915 putative glucosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>cd02525 Succinoglycan_BP_ExoA ExoA is involved in the biosynthesis of succinoglycan Back     alignment and domain information
>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>cd04185 GT_2_like_b Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>PRK14583 hmsR N-glycosyltransferase; Provisional Back     alignment and domain information
>cd04192 GT_2_like_e Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd06421 CESA_CelA_like CESA_CelA_like are involved in the elongation of the glucan chain of cellulose Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>cd06436 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine Back     alignment and domain information
>cd06427 CESA_like_2 CESA_like_2 is a member of the cellulose synthase superfamily Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>cd06438 EpsO_like EpsO protein participates in the methanolan synthesis Back     alignment and domain information
>KOG2978|consensus Back     alignment and domain information
>cd06420 GT2_Chondriotin_Pol_N N-terminal domain of Chondroitin polymerase functions as a GalNAc transferase Back     alignment and domain information
>cd06433 GT_2_WfgS_like WfgS and WfeV are involved in O-antigen biosynthesis Back     alignment and domain information
>PF13641 Glyco_tranf_2_3: Glycosyltransferase like family 2; PDB: 4FIY_B 4FIX_A Back     alignment and domain information
>cd06442 DPM1_like DPM1_like represents putative enzymes similar to eukaryotic DPM1 Back     alignment and domain information
>cd02511 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information
>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>TIGR03111 glyc2_xrt_Gpos1 putative glycosyltransferase TIGR03111 Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>TIGR03469 HonB hopene-associated glycosyltransferase HpnB Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>PLN02726 dolichyl-phosphate beta-D-mannosyltransferase Back     alignment and domain information
>cd04186 GT_2_like_c Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>TIGR03472 HpnI hopanoid biosynthesis associated glycosyl transferase protein HpnI Back     alignment and domain information
>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0463 WcaA Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02522 GT_2_like_a GT_2_like_a represents a glycosyltransferase family-2 subfamily with unknown function Back     alignment and domain information
>COG1216 Predicted glycosyltransferases [General function prediction only] Back     alignment and domain information
>PRK10018 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>cd04196 GT_2_like_d Subfamily of Glycosyltransferase Family GT2 of unknown function Back     alignment and domain information
>cd02526 GT2_RfbF_like RfbF is a putative dTDP-rhamnosyl transferase Back     alignment and domain information
>cd06434 GT2_HAS Hyaluronan synthases catalyze polymerization of hyaluronan Back     alignment and domain information
>cd06439 CESA_like_1 CESA_like_1 is a member of the cellulose synthase (CESA) superfamily Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>cd04179 DPM_DPG-synthase_like DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily Back     alignment and domain information
>PRK10073 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK10063 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin Back     alignment and domain information
>TIGR01556 rhamnosyltran L-rhamnosyltransferase Back     alignment and domain information
>cd04188 DPG_synthase DPG_synthase is involved in protein N-linked glycosylation Back     alignment and domain information
>PF10111 Glyco_tranf_2_2: Glycosyltransferase like family 2; InterPro: IPR019290 This conserved domain is found in a set of prokaryotic proteins including putative glucosyltransferases, which are involved in bacterial capsule biosynthesis [, ] Back     alignment and domain information
>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan Back     alignment and domain information
>PRK14716 bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>COG1215 Glycosyltransferases, probably involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04187 DPM1_like_bac Bacterial DPM1_like enzymes are related to eukaryotic DPM1 Back     alignment and domain information
>PF13712 Glyco_tranf_2_5: Glycosyltransferase like family; PDB: 2QGI_A 2NXV_B Back     alignment and domain information
>PF00535 Glycos_transf_2: Glycosyl transferase family 2; InterPro: IPR001173 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>KOG2977|consensus Back     alignment and domain information
>cd06423 CESA_like CESA_like is the cellulose synthase superfamily Back     alignment and domain information
>cd04190 Chitin_synth_C C-terminal domain of Chitin Synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin Back     alignment and domain information
>PF13632 Glyco_trans_2_3: Glycosyl transferase family group 2 Back     alignment and domain information
>PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd04191 Glucan_BSP_ModH Glucan_BSP_ModH catalyzes the elongation of beta-1,2 polyglucose chains of glucan Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>PRK05454 glucosyltransferase MdoH; Provisional Back     alignment and domain information
>PF13506 Glyco_transf_21: Glycosyl transferase family 21 Back     alignment and domain information
>PF02709 Glyco_transf_7C: N-terminal domain of galactosyltransferase; InterPro: IPR003859 This is a family of galactosyltransferases from a wide range of metazoa with three related galactosyltransferase activities; all three of which are possessed by one sequence in some cases Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>PRK14716 bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd06438 EpsO_like EpsO protein participates in the methanolan synthesis Back     alignment and domain information
>PRK15489 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>cd00761 Glyco_tranf_GTA_type Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold Back     alignment and domain information
>cd06436 GlcNAc-1-P_transferase N-acetyl-glucosamine transferase is involved in the synthesis of Poly-beta-1,6-N-acetyl-D-glucosamine Back     alignment and domain information
>PTZ00260 dolichyl-phosphate beta-glucosyltransferase; Provisional Back     alignment and domain information
>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides Back     alignment and domain information
>PRK11234 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>PRK05454 glucosyltransferase MdoH; Provisional Back     alignment and domain information
>PRK15489 nfrB bacteriophage N4 adsorption protein B; Provisional Back     alignment and domain information
>PRK13915 putative glucosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>PRK10714 undecaprenyl phosphate 4-deoxy-4-formamido-L-arabinose transferase; Provisional Back     alignment and domain information
>KOG3588|consensus Back     alignment and domain information
>KOG2547|consensus Back     alignment and domain information
>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2978|consensus Back     alignment and domain information
>PF05679 CHGN: Chondroitin N-acetylgalactosaminyltransferase; InterPro: IPR008428 This family represents Chondroitin N-acetylgalactosaminyltransferase Back     alignment and domain information
>cd02511 Beta4Glucosyltransferase UDP-glucose LOS-beta-1,4 glucosyltransferase is required for biosynthesis of lipooligosaccharide Back     alignment and domain information
>PF13712 Glyco_tranf_2_5: Glycosyltransferase like family; PDB: 2QGI_A 2NXV_B Back     alignment and domain information
>PF11397 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IPR021067 GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1; it is found in the cytoplasm and results in a pentasaccharide-linked 'HyPro-143[, ] Back     alignment and domain information
>KOG3916|consensus Back     alignment and domain information
>PF13704 Glyco_tranf_2_4: Glycosyl transferase family 2 Back     alignment and domain information
>PF03142 Chitin_synth_2: Chitin synthase; InterPro: IPR004835 Chitin synthase (2 Back     alignment and domain information
>PLN02893 Cellulose synthase-like protein Back     alignment and domain information
>PF03452 Anp1: Anp1; InterPro: IPR005109 The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function Back     alignment and domain information
>cd02514 GT13_GLCNAC-TI GT13_GLCNAC-TI is involved in an essential step in the synthesis of complex or hybrid-type N-linked oligosaccharides Back     alignment and domain information
>PF13506 Glyco_transf_21: Glycosyl transferase family 21 Back     alignment and domain information
>PF06306 CgtA: Beta-1,4-N-acetylgalactosaminyltransferase (CgtA); InterPro: IPR010446 This family consists of several beta-1,4-N-acetylgalactosaminyltransferase proteins from Campylobacter jejuni [] Back     alignment and domain information
>PF03071 GNT-I: GNT-I family; InterPro: IPR004139 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>COG4092 Predicted glycosyltransferase involved in capsule biosynthesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13896 Glyco_transf_49: Glycosyl-transferase for dystroglycan Back     alignment and domain information
>COG0463 WcaA Glycosyltransferases involved in cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG2547|consensus Back     alignment and domain information
>COG2943 MdoH Membrane glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03142 Chitin_synth_2: Chitin synthase; InterPro: IPR004835 Chitin synthase (2 Back     alignment and domain information
>PF09488 Osmo_MPGsynth: Mannosyl-3-phosphoglycerate synthase (osmo_MPGsynth); InterPro: IPR012812 This family consists of examples of mannosyl-3-phosphoglycerate synthase (MPGS), which together with mannosyl-3-phosphoglycerate phosphatase (MPGP), comprises a two-step pathway for mannosylglycerate biosynthesis Back     alignment and domain information
>PF11316 Rhamno_transf: Putative rhamnosyl transferase ; InterPro: IPR021466 This bacterial family of proteins has no known function Back     alignment and domain information
>KOG3917|consensus Back     alignment and domain information
>TIGR02460 osmo_MPGsynth mannosyl-3-phosphoglycerate synthase Back     alignment and domain information
>PRK14503 mannosyl-3-phosphoglycerate synthase; Provisional Back     alignment and domain information
>PF05679 CHGN: Chondroitin N-acetylgalactosaminyltransferase; InterPro: IPR008428 This family represents Chondroitin N-acetylgalactosaminyltransferase Back     alignment and domain information
>KOG2977|consensus Back     alignment and domain information
>PF11735 CAP59_mtransfer: Cryptococcal mannosyltransferase 1 ; InterPro: IPR021047 The capsule of pathogenic fungi is a complex polysaccharide whose formation is determined by a number of enzymes including, most importantly, alpha-1,3-mannosyltransferase 1 [, ] Back     alignment and domain information
>PF09258 Glyco_transf_64: Glycosyl transferase family 64 domain; InterPro: IPR015338 Members of this entry catalyse the transfer reaction of N-acetylglucosamine and N-acetylgalactosamine from the respective UDP-sugars to the non-reducing end of [glucuronic acid]beta 1-3[galactose]beta 1-O-naphthalenemethanol, an acceptor substrate analogue of the natural common linker of various glycosylaminoglycans Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>cd00218 GlcAT-I Beta1,3-glucuronyltransferase I (GlcAT-I) is involved in the initial steps of proteoglycan synthesis Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>KOG1476|consensus Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>KOG2571|consensus Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>PF03214 RGP: Reversibly glycosylated polypeptide; InterPro: IPR004901 Alpha-1,4-glucan-protein synthase catalyses the reaction: protein + UDP-D-glucose = alpha-D-glucosyl-protein + UDP The enzyme has a possible role in the synthesis of cell wall polysaccharides in plants [] Back     alignment and domain information
>KOG3588|consensus Back     alignment and domain information
>COG1209 RfbA dTDP-glucose pyrophosphorylase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03452 Anp1: Anp1; InterPro: IPR005109 The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>PLN02458 transferase, transferring glycosyl groups Back     alignment and domain information
>COG1213 Predicted sugar nucleotidyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15480 glucose-1-phosphate thymidylyltransferase RfbA; Provisional Back     alignment and domain information
>PF01762 Galactosyl_T: Galactosyltransferase; InterPro: IPR002659 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN02195 cellulose synthase A Back     alignment and domain information
>PRK00317 mobA molybdopterin-guanine dinucleotide biosynthesis protein MobA; Reviewed Back     alignment and domain information
>cd04181 NTP_transferase NTP_transferases catalyze the transfer of nucleotides onto phosphosugars Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>TIGR03202 pucB xanthine dehydrogenase accessory protein pucB Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>cd06425 M1P_guanylylT_B_like_N N-terminal domain of the M1P-guanylyltransferase B-isoform like proteins Back     alignment and domain information
>PF12804 NTP_transf_3: MobA-like NTP transferase domain; PDB: 3FWW_A 2XME_D 2XMH_C 2DPW_A 2WAW_A 2OI5_B 1HV9_B 1FWY_A 2OI6_A 2OI7_B Back     alignment and domain information
>TIGR01207 rmlA glucose-1-phosphate thymidylyltransferase, short form Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>PLN02893 Cellulose synthase-like protein Back     alignment and domain information
>PF13632 Glyco_trans_2_3: Glycosyl transferase family group 2 Back     alignment and domain information
>PLN02189 cellulose synthase Back     alignment and domain information
>PF13733 Glyco_transf_7N: N-terminal region of glycosyl transferase group 7; PDB: 2AGD_B 3EE5_A 2AE7_B 2AEC_A 2FYA_A 2AES_B 2AH9_A 2FYB_A 2FY7_A 3LW6_A Back     alignment and domain information
>cd06431 GT8_LARGE_C LARGE catalytic domain has closest homology to GT8 glycosyltransferase involved in lipooligosaccharide synthesis Back     alignment and domain information
>cd06422 NTP_transferase_like_1 NTP_transferase_like_1 is a member of the nucleotidyl transferase family Back     alignment and domain information
>PF01697 Glyco_transf_92: Glycosyltransferase family 92; InterPro: IPR008166 This entry represents a region approximately 300 residues long that is of unknown function Back     alignment and domain information
>PRK13368 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>COG1211 IspD 4-diphosphocytidyl-2-methyl-D-erithritol synthase [Lipid metabolism] Back     alignment and domain information
>PF04666 Glyco_transf_54: N-Acetylglucosaminyltransferase-IV (GnT-IV) conserved region; InterPro: IPR006759 The complex-type of oligosaccharides are synthesised through elongation by glycosyltransferases after trimming of the precursor oligosaccharides transferred to proteins in the endoplasmic reticulum Back     alignment and domain information
>cd06428 M1P_guanylylT_A_like_N N-terminal domain of M1P_guanylyl_A_ like proteins are likely to be a isoform of GDP-mannose pyrophosphorylase Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>PF11397 GlcNAc: Glycosyltransferase (GlcNAc); InterPro: IPR021067 GlcNAc is an enzyme that carries out the first glycosylation step of hydroxylated Skp1; it is found in the cytoplasm and results in a pentasaccharide-linked 'HyPro-143[, ] Back     alignment and domain information
>TIGR03552 F420_cofC 2-phospho-L-lactate guanylyltransferase CofC Back     alignment and domain information
>cd04189 G1P_TT_long G1P_TT_long represents the long form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>cd06915 NTP_transferase_WcbM_like WcbM_like is a subfamily of nucleotidyl transferases Back     alignment and domain information
>cd02538 G1P_TT_short G1P_TT_short is the short form of glucose-1-phosphate thymidylyltransferase Back     alignment and domain information
>KOG1413|consensus Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>cd00899 b4GalT Beta-4-Galactosyltransferase is involved in the formation of the poly-N-acetyllactosamine core structures present in glycoproteins and glycosphingolipids Back     alignment and domain information
>PLN02248 cellulose synthase-like protein Back     alignment and domain information
>PRK13385 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Provisional Back     alignment and domain information
>cd02509 GDP-M1P_Guanylyltransferase GDP-M1P_Guanylyltransferase catalyzes the formation of GDP-Mannose Back     alignment and domain information
>cd02518 GT2_SpsF SpsF is a glycosyltrnasferase implicated in the synthesis of the spore coat Back     alignment and domain information
>PRK00155 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; Reviewed Back     alignment and domain information
>cd04182 GT_2_like_f GT_2_like_f is a subfamily of the glycosyltransferase family 2 (GT-2) with unknown function Back     alignment and domain information
>PRK14353 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PLN03180 reversibly glycosylated polypeptide; Provisional Back     alignment and domain information
>cd00505 Glyco_transf_8 Members of glycosyltransferase family 8 (GT-8) are involved in lipopolysaccharide biosynthesis and glycogen synthesis Back     alignment and domain information
>COG2068 Uncharacterized MobA-related protein [General function prediction only] Back     alignment and domain information
>PRK09382 ispDF bifunctional 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase/2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase protein; Provisional Back     alignment and domain information
>PLN02917 CMP-KDO synthetase Back     alignment and domain information
>cd04198 eIF-2B_gamma_N The N-terminal domain of gamma subunit of the eIF-2B is a subfamily of glycosyltransferase 2 Back     alignment and domain information
>PLN02190 cellulose synthase-like protein Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>PRK05450 3-deoxy-manno-octulosonate cytidylyltransferase; Provisional Back     alignment and domain information
>cd06426 NTP_transferase_like_2 NTP_trnasferase_like_2 is a member of the nucleotidyl transferase family Back     alignment and domain information
>PLN03153 hypothetical protein; Provisional Back     alignment and domain information
>PRK02726 molybdopterin-guanine dinucleotide biosynthesis protein A; Provisional Back     alignment and domain information
>COG1208 GCD1 Nucleoside-diphosphate-sugar pyrophosphorylase involved in lipopolysaccharide biosynthesis/translation initiation factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) [Cell envelope biogenesis, outer membrane / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF03214 RGP: Reversibly glycosylated polypeptide; InterPro: IPR004901 Alpha-1,4-glucan-protein synthase catalyses the reaction: protein + UDP-D-glucose = alpha-D-glucosyl-protein + UDP The enzyme has a possible role in the synthesis of cell wall polysaccharides in plants [] Back     alignment and domain information
>TIGR03310 matur_ygfJ molybdenum hydroxylase accessory protein, YgfJ family Back     alignment and domain information
>cd02513 CMP-NeuAc_Synthase CMP-NeuAc_Synthase activates N-acetylneuraminic acid by adding CMP moiety Back     alignment and domain information
>PRK14352 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PF00483 NTP_transferase: Nucleotidyl transferase This Prosite entry is only a sub-family of the Pfam entry Back     alignment and domain information
>TIGR02665 molyb_mobA molybdopterin-guanine dinucleotide biosynthesis protein A, proteobacterial Back     alignment and domain information
>KOG3916|consensus Back     alignment and domain information
>COG2943 MdoH Membrane glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd02540 GT2_GlmU_N_bac N-terminal domain of bacterial GlmU Back     alignment and domain information
>cd02516 CDP-ME_synthetase CDP-ME synthetase is involved in mevalonate-independent isoprenoid production Back     alignment and domain information
>PRK14355 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>PLN02190 cellulose synthase-like protein Back     alignment and domain information
>TIGR03584 PseF pseudaminic acid CMP-transferase Back     alignment and domain information
>cd04183 GT2_BcE_like GT2_BcbE_like is likely involved in the biosynthesis of the polysaccharide capsule Back     alignment and domain information
>PF02434 Fringe: Fringe-like; InterPro: IPR003378 The Notch receptor is a large, cell surface transmembrane protein involved in a wide variety of developmental processes in higher organisms [] Back     alignment and domain information
>cd04194 GT8_A4GalT_like A4GalT_like proteins catalyze the addition of galactose or glucose residues to the lipooligosaccharide (LOS) or lipopolysaccharide (LPS) of the bacterial cell surface Back     alignment and domain information
>PRK14360 glmU bifunctional N-acetylglucosamine-1-phosphate uridyltransferase/glucosamine-1-phosphate acetyltransferase; Provisional Back     alignment and domain information
>cd02517 CMP-KDO-Synthetase CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide Back     alignment and domain information
>TIGR01173 glmU UDP-N-acetylglucosamine diphosphorylase/glucosamine-1-phosphate N-acetyltransferase Back     alignment and domain information
>PF13896 Glyco_transf_49: Glycosyl-transferase for dystroglycan Back     alignment and domain information
>cd02508 ADP_Glucose_PP ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch Back     alignment and domain information
>TIGR00466 kdsB 3-deoxy-D-manno-octulosonate cytidylyltransferase Back     alignment and domain information
>cd02503 MobA MobA catalyzes the formation of molybdopterin guanine dinucleotide Back     alignment and domain information
>TIGR00453 ispD 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information
>KOG1022|consensus Back     alignment and domain information
>TIGR00454 conserved hypothetical protein TIGR00454 Back     alignment and domain information
>PF03552 Cellulose_synt: Cellulose synthase; InterPro: IPR005150 Cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues, is the major component of wood and thus paper, and is synthesized by plants, most algae, some bacteria and fungi, and even some animals Back     alignment and domain information
>PLN02638 cellulose synthase A (UDP-forming), catalytic subunit Back     alignment and domain information
>PRK15171 lipopolysaccharide 1,3-galactosyltransferase; Provisional Back     alignment and domain information
>cd02541 UGPase_prokaryotic Prokaryotic UGPase catalyses the synthesis of UDP-glucose Back     alignment and domain information
>TIGR01105 galF UTP-glucose-1-phosphate uridylyltransferase, non-catalytic GalF subunit Back     alignment and domain information
>cd02523 PC_cytidylyltransferase Phosphocholine cytidylyltransferases catalyze the synthesis of CDP-choline Back     alignment and domain information
>PLN02728 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
2d7i_A570 Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac 7e-49
2d7i_A 570 Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac 8e-47
1xhb_A 472 The Crystal Structure Of Udp-Galnac: Polypeptide Al 2e-45
2ffu_A501 Crystal Structure Of Human Ppgalnact-2 Complexed Wi 5e-39
2ffu_A 501 Crystal Structure Of Human Ppgalnact-2 Complexed Wi 5e-36
>pdb|2D7I|A Chain A, Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac And Mn2+ Length = 570 Back     alignment and structure

Iteration: 1

Score = 191 bits (485), Expect = 7e-49, Method: Compositional matrix adjust. Identities = 96/187 (51%), Positives = 125/187 (66%), Gaps = 5/187 (2%) Query: 2 LDKKLEDYIERFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPL 61 L K LEDY+ F VR++R +REGLIRTR GA + G+VI FLD+HCE +NWLPPL Sbjct: 159 LKKPLEDYMALFPS-VRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPL 217 Query: 62 LAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELPEREAKKRK 121 L I +RK + P+ID ID+ +FR + RG F+W M YK +P K Sbjct: 218 LDRIARNRKTIVCPMIDVIDHD--DFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADP 275 Query: 122 YNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGENFELSFKIWMCGGSIEWVPCS 181 S+P++SP AGGLFA+DR +F ELGGYDPGL +WGGE +E+SFK+WMCGG +E +PCS Sbjct: 276 --SDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCS 333 Query: 182 RIVSLIR 188 R+ + R Sbjct: 334 RVGHIYR 340
>pdb|2D7I|A Chain A, Crsytal Structure Of Pp-Galnac-T10 With Udp, Galnac And Mn2+ Length = 570 Back     alignment and structure
>pdb|1XHB|A Chain A, The Crystal Structure Of Udp-Galnac: Polypeptide Alpha-N- Acetylgalactosaminyltransferase-T1 Length = 472 Back     alignment and structure
>pdb|2FFU|A Chain A, Crystal Structure Of Human Ppgalnact-2 Complexed With Udp And Ea2 Length = 501 Back     alignment and structure
>pdb|2FFU|A Chain A, Crystal Structure Of Human Ppgalnact-2 Complexed With Udp And Ea2 Length = 501 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query439
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 2e-75
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 2e-62
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 2e-75
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 7e-61
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 1e-73
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 2e-57
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 1e-16
2z86_A 625 Chondroitin synthase; GT-A, glycosyltransferase A, 2e-06
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 6e-09
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 2e-07
2nxv_A249 ATP synthase subunits region ORF 6; majastridin, A 1e-04
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure
 Score =  242 bits (619), Expect = 2e-75
 Identities = 89/197 (45%), Positives = 128/197 (64%), Gaps = 3/197 (1%)

Query: 242 SNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYL 301
           S  I+ +R++PD+R+E CK   YP +LP  SV++VFHNE +S+L+RTVHS+I R+P   +
Sbjct: 2   SEMIALNRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMI 61

Query: 302 EEIILVDDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFL 361
           EEI+LVDD S +  L + LE Y+++    V +IR  +R GLIR R +GA  SRG+VI FL
Sbjct: 62  EEIVLVDDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFL 121

Query: 362 DAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLY 421
           DAHCE    WL PLLA I  DR+ +  P+ID I   T+E+ +  +      G F W + +
Sbjct: 122 DAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAGSD---MTYGGFNWKLNF 178

Query: 422 KENELPEREAKKRKYNR 438
           +   +P+RE  +RK +R
Sbjct: 179 RWYPVPQREMDRRKGDR 195


>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Length = 472 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Length = 570 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Length = 501 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Length = 625 Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Length = 729 Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Length = 255 Back     alignment and structure
>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Length = 249 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query439
2z86_A625 Chondroitin synthase; GT-A, glycosyltransferase A, 100.0
2d7i_A 570 Polypeptide N-acetylgalactosaminyltransferase 10; 99.97
1xhb_A 472 Polypeptide N-acetylgalactosaminyltransferase 1; g 99.96
2ffu_A 501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 99.96
1xhb_A472 Polypeptide N-acetylgalactosaminyltransferase 1; g 99.95
2d7i_A570 Polypeptide N-acetylgalactosaminyltransferase 10; 99.94
2ffu_A501 Ppgalnact-2, polypeptide N-acetylgalactosaminyltra 99.93
3bcv_A240 Putative glycosyltransferase protein; protein stru 99.89
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 99.87
3bcv_A240 Putative glycosyltransferase protein; protein stru 99.86
4fix_A657 UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 99.82
3ckj_A 329 Putative uncharacterized protein; mycobacteria, un 99.8
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 99.78
1qg8_A255 Protein (spore coat polysaccharide biosynthesis P 99.77
2nxv_A249 ATP synthase subunits region ORF 6; majastridin, A 99.77
3f1y_A 387 Mannosyl-3-phosphoglycerate synthase; GT-A type gl 99.76
2z86_A 625 Chondroitin synthase; GT-A, glycosyltransferase A, 99.74
4fix_A 657 UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 99.72
4hg6_A 802 Cellulose synthase subunit A; membrane translocati 99.7
2fy7_A287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 99.69
3l7i_A 729 Teichoic acid biosynthesis protein F; GT-B fold, m 99.65
4hg6_A 802 Cellulose synthase subunit A; membrane translocati 99.62
2nxv_A249 ATP synthase subunits region ORF 6; majastridin, A 99.56
2wvl_A 391 Mannosyl-3-phosphoglycerate synthase; GT-A fold, t 99.52
3ckj_A329 Putative uncharacterized protein; mycobacteria, un 99.47
2bo4_A 397 Mannosylglycerate synthase; catalysis, glycosyltra 99.47
2fy7_A287 Beta-1,4-galactosyltransferase 1; M339H mutant, AP 99.35
3f1y_A387 Mannosyl-3-phosphoglycerate synthase; GT-A type gl 99.33
2zu9_A 394 Mannosyl-3-phosphoglycerate synthase; GT-A fold, g 99.33
1fo8_A 343 Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetyl 99.06
3lw6_A287 FI08434P, beta-4-galactosyltransferase 7; protein- 98.94
2bo4_A397 Mannosylglycerate synthase; catalysis, glycosyltra 98.62
2c0n_A203 A197; thermophil protein, thermophilic virus, STIV 98.23
1fo8_A343 Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetyl 97.49
2wvl_A391 Mannosyl-3-phosphoglycerate synthase; GT-A fold, t 97.25
1omz_A 293 Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; ro 95.6
2d0j_A246 Galactosylgalactosylxylosylprotein 3-beta- glucuro 95.44
3cu0_A281 Galactosylgalactosylxylosylprotein 3-beta- glucuro 94.9
1v84_A253 Galactosylgalactosylxylosylprotein 3-beta- glucuro 94.45
2zu9_A394 Mannosyl-3-phosphoglycerate synthase; GT-A fold, g 94.25
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 93.94
3lw6_A287 FI08434P, beta-4-galactosyltransferase 7; protein- 93.8
2c0n_A203 A197; thermophil protein, thermophilic virus, STIV 93.26
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 93.11
3oam_A252 3-deoxy-manno-octulosonate cytidylyltransferase; c 93.07
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 93.04
1qwj_A229 Cytidine monophospho-N-acetylneuraminic acid synth 92.42
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 92.39
3tzt_A276 Glycosyl transferase family 8; structural genomics 92.17
3tqd_A256 3-deoxy-manno-octulosonate cytidylyltransferase; c 91.63
1fxo_A 293 Glucose-1-phosphate thymidylyltransferase; rhamnos 91.35
1ezi_A228 CMP-N-acetylneuraminic acid synthetase; homodimer, 91.1
1h7e_A245 3-deoxy-manno-octulosonate cytidylyltransferase; n 90.91
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 90.87
1lvw_A 295 Glucose-1-phosphate thymidylyltransferase; protein 90.41
4ecm_A269 Glucose-1-phosphate thymidylyltransferase; HET: DA 90.32
3k8d_A264 3-deoxy-manno-octulosonate cytidylyltransferase; K 89.99
3st8_A 501 Bifunctional protein GLMU; acetyltransferase, pyro 89.83
2wee_A197 MOBA-related protein; unknown function; 1.65A {Myc 89.49
1e5k_A201 Molybdopterin-guanine dinucleotide biosynthesis pr 88.91
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 88.61
1mc3_A 296 Glucose-1-phosphate thymidylyltransferase; glucose 88.55
2ux8_A297 Glucose-1-phosphate uridylyltransferase; UGPG, GAL 87.8
2waw_A199 MOBA relate protein; unknown function; HET: PGE; 1 87.09
3f1c_A246 Putative 2-C-methyl-D-erythritol 4-phosphate cytid 86.96
4fce_A459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 86.74
3ngw_A208 Molybdopterin-guanine dinucleotide biosynthesis P 86.41
3d5n_A197 Q97W15_sulso; NESG, SSR125, structural genomics, P 86.37
2y6p_A234 3-deoxy-manno-octulosonate cytidylyltransferase; l 86.08
4fcu_A253 3-deoxy-manno-octulosonate cytidylyltransferase; s 86.02
3q80_A231 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; 85.77
2e3d_A302 UTP--glucose-1-phosphate uridylyltransferase; UDP- 85.67
1vgw_A231 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; 85.46
4fce_A 459 Bifunctional protein GLMU; GLMU. csgid, niaid, str 85.18
1g9r_A 311 Glycosyl transferase; alpha-beta structure; HET: U 84.92
2qh5_A 308 PMI, ALGA, mannose-6-phosphate isomerase; structur 84.9
1w55_A 371 ISPD/ISPF bifunctional enzyme; biosynthetic pathwa 84.87
2vsh_A236 TARI, 2-C-methyl-D-erythritol 4-phosphate cytidyly 83.98
3pnn_A 303 Conserved domain protein; structural genomics, PSI 83.66
2xwl_A223 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; 82.82
1hm9_A468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 81.87
2pa4_A 323 UTP-glucose-1-phosphate uridylyltransferase; phosp 81.85
2yc3_A228 2-C-methyl-D-erythritol 4-phosphate cytidylyltran 81.13
3juk_A281 UDP-glucose pyrophosphorylase (GALU); transfer; HE 80.7
1hm9_A 468 GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltr 80.19
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-42  Score=359.38  Aligned_cols=338  Identities=17%  Similarity=0.189  Sum_probs=230.9

Q ss_pred             CcEEEEEecCC-CChhHHHHhhhhhccCcEEEEecCCcccCCCchHHHHHHHhcCCCeEeeeeeecccCCCcccccc---
Q psy8674          15 GKVRLIRNTER-EGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSV---   90 (439)
Q Consensus        15 ~~i~~i~~~~n-~G~a~arN~G~~~A~g~~i~flD~D~~~~~~~l~~l~~~~~~~~~~~v~~~~~~~~~~~~~~~~~---   90 (439)
                      ++++++.++.+ .|.++|+|.|++.|+|+||+|+|+|+.++|+||+.+++.+.+++..++.+...............   
T Consensus       148 ~~i~~i~~~~~~~g~~~a~N~g~~~a~g~~v~~lD~D~~~~~~~l~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~  227 (625)
T 2z86_A          148 LNIKYVRQKDYGYQLCAVRNLGLRAAKYNYVAILDCDMAPNPLWVQSYMELLAVDDNVALIGPRKYIDTSKHTYLDFLSQ  227 (625)
T ss_dssp             SCEEEEEECCCSCCHHHHHHHHHHHCCSSEEEEECTTEEECTTHHHHHHHHHHHCTTEEEECCEEEECCTTCCHHHHHHS
T ss_pred             CCeEEEEeCCCCcchhHHHHHHHHhCCcCEEEEECCCCCCCHHHHHHHHHHHhcCCceEEEEeeeeccCcccchhhcccc
Confidence            37999987653 46999999999999999999999999999999999999999877765554443332222100000   


Q ss_pred             ---------cCCCCccccccccccccccCCCchHHHhhccCCCCCccCccccceEEEEeHHHHHHhCCCCCCCCCccchh
Q psy8674          91 ---------YEPDHHYRGIFEWGMLYKENELPEREAKKRKYNSEPYKSPTHAGGLFAMDRAFFLELGGYDPGLLVWGGEN  161 (439)
Q Consensus        91 ---------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~irr~~f~~iGgfde~~~~~~~ED  161 (439)
                               ........+.+.......|.  ...................+.|+|+++||++|+++|||||.++.||+||
T Consensus       228 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~g~~~~~rr~~l~~iGgfde~~~~~g~ED  305 (625)
T 2z86_A          228 KSLINEIPEIITNNQVAGKVEQNKSVDWR--IEHFKNTDNLRLCNTPFRFFSGGNVAFAKKWLFRAGWFDEEFTHWGGED  305 (625)
T ss_dssp             TTGGGTSCC---------------CCCTH--HHHHHHTTTTTTCSCGGGGCCTTEEEEETHHHHHHCCCCTTCSSCCCHH
T ss_pred             hHHhhhcchhccCCchhhhhccCCccccc--hhhhcccccccccCCceeEEeeceeeeEHHHHHHhCCCccccccCCcch
Confidence                     00000000100000000000  0000000011122234446789999999999999999999999888899


Q ss_pred             hHHHHHHHHhCCcEEEecccceecccccccccCCcCCCCCCCCCCCCCCCCCCCccccCcHhHHhhhhhhhhhcccceec
Q psy8674         162 FELSFKIWMCGGSIEWVPCSRIVSLIRPVFKADGKLGNLEPPLEPYKEGPGEGGKAYHLPEAYRAAGDASLGEYGMNMET  241 (439)
Q Consensus       162 ~Dl~~Rl~~~G~~i~~~p~~~v~H~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~l~~~~~~~~~~~~~~~~~~~~~  241 (439)
                      +||++|++++|+++.++|.+.++|..++.......               ...++.          ....+.....    
T Consensus       306 ~dl~~Rl~~~G~~i~~~p~~~v~H~~~~~~~~~~~---------------~~~~~~----------i~~~~~~~~~----  356 (625)
T 2z86_A          306 NEFGYRLYREGCYFRSVEGAMAYHQEPPGKENETD---------------RAAGKN----------ITVQLLQQKV----  356 (625)
T ss_dssp             HHHHHHHHHTTCEEEECGGGCEEEECCC-----------------------------------------CTTTTTC----
T ss_pred             hhhhhhHHhCCceEEEcccchhhccCCccccchhh---------------hhhccc----------chhhhcccCc----
Confidence            99999999999999999999999998766443210               000000          0000000000    


Q ss_pred             ccccCCCCCCCcccccccccccCCCCCCceEEEEEecCCChhHHHHHHHHHHhcCCcCCcceEEEEeCCCChhhHHHHHH
Q psy8674         242 SNHISFDRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLE  321 (439)
Q Consensus       242 ~~~~~~~~~~~~~~~~~~~~~~~~~~~p~vsiiip~~n~~~~~l~~~l~sl~~q~~~~~~~eiivvdd~s~d~t~~~~~~  321 (439)
                         ....|....      ......+.+|+||||||+||+. +.|.+||+|+++|+++++  |||||||||+|+|.+ +++
T Consensus       357 ---~~~~rk~~~------~~~~~~~~~~~vsiii~~yn~~-~~l~~~l~s~~~q~~~~~--eiivvdd~S~d~t~~-~~~  423 (625)
T 2z86_A          357 ---PYFYRKKEK------IESATLKRVPLVSIYIPAYNCS-KYIVRCVESALNQTITDL--EVCICDDGSTDDTLR-ILQ  423 (625)
T ss_dssp             ---TTTTCCCCC------TTTCCCCSSCSEEEEEEESSCT-TTHHHHHHHHHSSSCCSE--EEEEEEESCSSSHHH-HHH
T ss_pred             ---ceEEecccc------cccchhccCCeEEEEEeCCCCH-HHHHHHHHHHHhCcCCCe--EEEEEECcCChhHHH-HHH
Confidence               000111100      0011124578999999999999 999999999999999877  999999999999987 888


Q ss_pred             HHHHHcCCcEEEEEcCCCCCHHHHHHHHHhhcCCCEEEEEcCCCccCCCChHHHHHhhhcCC-CEEEEeeeeeecCCC
Q psy8674         322 DYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDR-KIMTVPVIDGIDYQT  398 (439)
Q Consensus       322 ~~~~~~~~~v~~i~~~~~~g~~~a~n~g~~~a~~d~i~~ld~D~~~~~~~l~~l~~~~~~~~-~~~v~~~~~~~~~~~  398 (439)
                      ++.+..+ +++++. .+|.|.+.++|.|++.|+||||+|+|+|+.+.|++|+.+++.+..++ .+++++....++.+.
T Consensus       424 ~~~~~~~-~i~~~~-~~n~G~~~a~n~g~~~a~g~~i~~ld~D~~~~~~~l~~~~~~~~~~~~~~~v~~~~~~~~~~~  499 (625)
T 2z86_A          424 EHYANHP-RVRFIS-QKNKGIGSASNTAVRLCRGFYIGQLDSDDFLEPDAVELCLDEFRKDLSLACVYTTNRNIDREG  499 (625)
T ss_dssp             HHHTTCT-TEEEEE-ECCCCHHHHHHHHHHHCCSSEEEECCTTCEECTTHHHHHHHHHHHCTTCSEEEEEEEEECTTS
T ss_pred             HHHhhCC-cEEEEe-CCCCCHHHHHHHHHHhcCCCEEEEECCCcccChhHHHHHHHHHHhCCCeeEEEeeeEEECCCC
Confidence            8876655 799986 78999999999999999999999999999999999999999997654 466767665555544



>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>1xhb_A Polypeptide N-acetylgalactosaminyltransferase 1; glycosyltransferase-A (GT-A); HET: NAG BMA; 2.50A {Mus musculus} SCOP: b.42.2.1 c.68.1.17 Back     alignment and structure
>2d7i_A Polypeptide N-acetylgalactosaminyltransferase 10; beta trefoil, rossmann fold; HET: NAG NGA UDP; 2.50A {Homo sapiens} PDB: 2d7r_A* Back     alignment and structure
>2ffu_A Ppgalnact-2, polypeptide N-acetylgalactosaminyltransferase 2, protein-UDP; ppgalnact, mucin, glycosyltransferase; HET: UDP; 1.64A {Homo sapiens} PDB: 2ffv_A* Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
>3bcv_A Putative glycosyltransferase protein; protein structure initiative II, PSI-II NYSGXRC, structural genomics; 2.35A {Bacteroides fragilis} Back     alignment and structure
>4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A* Back     alignment and structure
>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Back     alignment and structure
>1qg8_A Protein (spore coat polysaccharide biosynthesis P SPSA); glycosyltransferase, transferase; 1.50A {Bacillus subtilis} SCOP: c.68.1.1 PDB: 1h7q_A* 1h7l_A 1qgq_A* 1qgs_A* Back     alignment and structure
>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Back     alignment and structure
>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Back     alignment and structure
>2z86_A Chondroitin synthase; GT-A, glycosyltransferase A, fold; HET: UGA UDP; 2.40A {Escherichia coli} PDB: 2z87_A* Back     alignment and structure
>4fix_A UDP-galactofuranosyl transferase GLFT2; CAZY GT-2 family, glycosyltrans carbohydrate binding, membrane; 2.45A {Mycobacterium tuberculosis} PDB: 4fiy_A* Back     alignment and structure
>4hg6_A Cellulose synthase subunit A; membrane translocation, cellulose synthesis, UDP-GLC binding membrane, transferase; HET: BGC UDP LDA; 3.25A {Rhodobacter sphaeroides} Back     alignment and structure
>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Back     alignment and structure
>3l7i_A Teichoic acid biosynthesis protein F; GT-B fold, monotopic membrane protein, structural protein; 2.70A {Staphylococcus epidermidis} PDB: 3l7j_A 3l7k_A* 3l7l_A* 3l7m_A* Back     alignment and structure
>4hg6_A Cellulose synthase subunit A; membrane translocation, cellulose synthesis, UDP-GLC binding membrane, transferase; HET: BGC UDP LDA; 3.25A {Rhodobacter sphaeroides} Back     alignment and structure
>2nxv_A ATP synthase subunits region ORF 6; majastridin, ATPase operon, glycosyl transferase, rossmann F sulphur SAD, transferase; 1.10A {Rhodobacter blasticus} PDB: 2qgi_A* Back     alignment and structure
>2wvl_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, transferase, glycosyltransferase, retaining mecha glucosyl transferase; HET: GDD; 2.81A {Thermus thermophilus} PDB: 2wvk_A* 2wvm_A* Back     alignment and structure
>3ckj_A Putative uncharacterized protein; mycobacteria, unknown function; HET: CIT; 1.80A {Mycobacterium paratuberculosis} PDB: 3ckn_A* 3cko_A* 3ckq_A* 3ckv_A* 3e26_A 3e25_A Back     alignment and structure
>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Back     alignment and structure
>2fy7_A Beta-1,4-galactosyltransferase 1; M339H mutant, APO enzyme; HET: PGE; 1.70A {Homo sapiens} PDB: 2aec_A* 2aes_A* 2ae7_A* 2ah9_A* 2agd_A* 2fya_A* 2fyb_A* 3ee5_A* 2fyc_B* 1tw1_A* 1tw5_A* 1tvy_A* 1nmm_B* 1o0r_A* 1yro_B* 1nf5_B* 1nhe_B* 1nkh_B* 1nqi_B* 1nwg_B* ... Back     alignment and structure
>3f1y_A Mannosyl-3-phosphoglycerate synthase; GT-A type glycosyltransferase, GT-81, mannosyl-3-phosphoglyc synthase, GDP-mannose, transferas; 2.20A {Rubrobacter xylanophilus} PDB: 3kia_A* 3o3p_A* Back     alignment and structure
>2zu9_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, glycosyltransferase, GT55, GDP, cytoplasm, magnesium, transferase; HET: GDP; 2.00A {Pyrococcus horikoshii} PDB: 2zu7_A* 2zu8_A* Back     alignment and structure
>1fo8_A Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylglucosaminyltransferase; methylmercury derivative, N- acetylglucosaminyltransferase I; 1.40A {Oryctolagus cuniculus} SCOP: c.68.1.10 PDB: 1fo9_A 1foa_A* 2apc_A* 2am3_A* 2am4_A* 2am5_A* Back     alignment and structure
>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} Back     alignment and structure
>2bo4_A Mannosylglycerate synthase; catalysis, glycosyltransferase, mannose, transferase, stereoselectivity; HET: FLC; 1.95A {Rhodothermus marinus} SCOP: c.68.1.18 PDB: 2bo6_A 2bo7_A* 2bo8_A* 2xw2_A 2y4j_A 2xw3_A* 2xw4_A* 2xw5_A* 2y4k_A* 2y4l_A* 2y4m_A* Back     alignment and structure
>2c0n_A A197; thermophil protein, thermophilic virus, STIV, sulfolobus turreted ICOS virus; 1.86A {Sulfolobus turreted icosahedral virus} Back     alignment and structure
>1fo8_A Alpha-1,3-mannosyl-glycoprotein beta-1,2-N- acetylglucosaminyltransferase; methylmercury derivative, N- acetylglucosaminyltransferase I; 1.40A {Oryctolagus cuniculus} SCOP: c.68.1.10 PDB: 1fo9_A 1foa_A* 2apc_A* 2am3_A* 2am4_A* 2am5_A* Back     alignment and structure
>2wvl_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, transferase, glycosyltransferase, retaining mecha glucosyl transferase; HET: GDD; 2.81A {Thermus thermophilus} PDB: 2wvk_A* 2wvm_A* Back     alignment and structure
>1omz_A Alpha-1,4-N-acetylhexosaminyltransferase EXTL2; rossmann fold, DXD motif; HET: UD2; 2.10A {Mus musculus} SCOP: c.68.1.15 PDB: 1omx_A* 1on6_A* 1on8_A* Back     alignment and structure
>2d0j_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 2; rossmann-like fold, glucuronyltransferase; 2.00A {Homo sapiens} Back     alignment and structure
>3cu0_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 3; glcat-I, glycosyltransferase, heparan sulfate biosynthesis, glycoprotein; HET: GAL UDP; 1.90A {Homo sapiens} SCOP: c.68.1.7 PDB: 1kws_A* 1fgg_A* Back     alignment and structure
>1v84_A Galactosylgalactosylxylosylprotein 3-beta- glucuronosyltransferase 1; glycoprotein, glycocyltransferase, HNK-1 epitop; HET: GAL NDG NAG TLA UDP; 1.82A {Homo sapiens} SCOP: c.68.1.7 PDB: 1v83_A* 1v82_A* Back     alignment and structure
>2zu9_A Mannosyl-3-phosphoglycerate synthase; GT-A fold, glycosyltransferase, GT55, GDP, cytoplasm, magnesium, transferase; HET: GDP; 2.00A {Pyrococcus horikoshii} PDB: 2zu7_A* 2zu8_A* Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>3lw6_A FI08434P, beta-4-galactosyltransferase 7; protein-Mn-UDP complex, glycosyltransferase; HET: UDP; 1.81A {Drosophila melanogaster} Back     alignment and structure
>2c0n_A A197; thermophil protein, thermophilic virus, STIV, sulfolobus turreted ICOS virus; 1.86A {Sulfolobus turreted icosahedral virus} Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>3oam_A 3-deoxy-manno-octulosonate cytidylyltransferase; center for structural genomics of infectious diseases; 1.75A {Vibrio cholerae o1 biovar el tor} SCOP: c.68.1.13 Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>1qwj_A Cytidine monophospho-N-acetylneuraminic acid synthetase; CMP-5-N-acetylneuraminic acid synthetase, CMP-NEU5AC, sialic acid, glycosylation; HET: NCC; 2.80A {Mus musculus} SCOP: c.68.1.13 Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>3tzt_A Glycosyl transferase family 8; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, putative glycosyl transferase; HET: MSE CIT; 2.10A {Anaerococcus prevotii} SCOP: c.68.1.0 Back     alignment and structure
>3tqd_A 3-deoxy-manno-octulosonate cytidylyltransferase; cell envelope; 1.80A {Coxiella burnetii} SCOP: c.68.1.0 Back     alignment and structure
>1fxo_A Glucose-1-phosphate thymidylyltransferase; rhamnose, nucleotidyltransferase, pyrophosphorylase, allostery; HET: TMP; 1.66A {Pseudomonas aeruginosa} SCOP: c.68.1.6 PDB: 1fzw_A 1g0r_A* 1g1l_A* 1g23_A* 1g2v_A* 1g3l_A* 1h5r_A* 1h5s_C* 1h5t_A* 1h5s_D* 1h5s_A* 1h5r_B* 1h5s_B* 1h5t_B* 1iim_A* 1iin_A* 3pkp_A* 3pkq_A* 1mp5_A* 1mp3_A* ... Back     alignment and structure
>1ezi_A CMP-N-acetylneuraminic acid synthetase; homodimer, alpha-beta-alpha, transferase; 2.00A {Neisseria meningitidis} SCOP: c.68.1.13 PDB: 1eyr_A Back     alignment and structure
>1h7e_A 3-deoxy-manno-octulosonate cytidylyltransferase; nucleotidyltransferase, CMP-KDO synthetase, nucleoside monophosphate glycosides; 1.83A {Escherichia coli} SCOP: c.68.1.13 PDB: 1gqc_A* 1gq9_A 1h6j_A 1h7f_A* 1h7g_A* 1h7h_A* 1h7t_A* Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>1lvw_A Glucose-1-phosphate thymidylyltransferase; protein nucleotide complex, nucleotide binding fold; HET: TYD; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.68.1.6 Back     alignment and structure
>4ecm_A Glucose-1-phosphate thymidylyltransferase; HET: DAU; 2.30A {Bacillus anthracis} PDB: 3hl3_A* Back     alignment and structure
>3k8d_A 3-deoxy-manno-octulosonate cytidylyltransferase; KDSB synthetase KDO complex, lipopolysaccharide biosynthesis magnesium, nucleotidyltransferase; HET: KDO CTP; 1.90A {Escherichia coli} SCOP: c.68.1.13 PDB: 3k8e_C 1vh1_A 3jtj_A* Back     alignment and structure
>3st8_A Bifunctional protein GLMU; acetyltransferase, pyrophosphorylase, rossmann fold, LEFT-handed-beta-helix, cell shape; HET: COA GP1 UD1; 1.98A {Mycobacterium tuberculosis} PDB: 3spt_A* 3foq_A 3dk5_A 3d8v_A 3d98_A* 3dj4_A 2qkx_A* Back     alignment and structure
>2wee_A MOBA-related protein; unknown function; 1.65A {Mycobacterium tuberculosis H37RV} PDB: 2we9_A 2yes_A Back     alignment and structure
>1e5k_A Molybdopterin-guanine dinucleotide biosynthesis protein A; molybdopterin nucleotidyl-transferase,; HET: CIT; 1.35A {Escherichia coli} SCOP: c.68.1.8 PDB: 1h4e_A* 1hjl_A* 1hjj_A* 1h4c_A* 1h4d_A* 1fr9_A 1frw_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Back     alignment and structure
>2ux8_A Glucose-1-phosphate uridylyltransferase; UGPG, GALU pyrophosphorylase, nucleotidyltransferase; HET: G1P; 2.65A {Sphingomonas elodea} Back     alignment and structure
>2waw_A MOBA relate protein; unknown function; HET: PGE; 1.60A {Mycobacterium SP} Back     alignment and structure
>3f1c_A Putative 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 2; structural genomics, PSI-2, protein structure initiative; 2.30A {Listeria monocytogenes str} SCOP: c.68.1.0 Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>3ngw_A Molybdopterin-guanine dinucleotide biosynthesis P (MOBA); alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.31A {Archaeoglobus fulgidus} Back     alignment and structure
>3d5n_A Q97W15_sulso; NESG, SSR125, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.80A {Sulfolobus solfataricus} Back     alignment and structure
>2y6p_A 3-deoxy-manno-octulosonate cytidylyltransferase; lipid A; HET: CTP; 2.10A {Aquifex aeolicus} Back     alignment and structure
>4fcu_A 3-deoxy-manno-octulosonate cytidylyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.90A {Acinetobacter baumannii} PDB: 3pol_A Back     alignment and structure
>3q80_A 2-C-methyl-D-erythritol 4-phosphate cytidyltransf; TB structural genomics consortium, TBSGC, rossman fold; HET: CDM; 2.00A {Mycobacterium tuberculosis} SCOP: c.68.1.0 PDB: 3q7u_A* 3okr_A 2xwn_A* Back     alignment and structure
>2e3d_A UTP--glucose-1-phosphate uridylyltransferase; UDP-glucose, carbohydrate, pyrophosphorylase; 1.95A {Escherichia coli} Back     alignment and structure
>1vgw_A 4-diphosphocytidyl-2C-methyl-D-erythritol synthas; structural genomics, transferase; 2.35A {Neisseria gonorrhoeae} SCOP: c.68.1.13 PDB: 1vgz_A Back     alignment and structure
>4fce_A Bifunctional protein GLMU; GLMU. csgid, niaid, structural genomics, national institute allergy and infectious diseases; HET: GP1; 1.96A {Yersinia pseudotuberculosis} PDB: 3fww_A 1hv9_A* 2oi5_A* 2oi6_A* 2oi7_A* 1fxj_A* 1fwy_A* Back     alignment and structure
>1g9r_A Glycosyl transferase; alpha-beta structure; HET: UPF; 2.00A {Neisseria meningitidis} SCOP: c.68.1.4 PDB: 1ga8_A* 1ss9_A* Back     alignment and structure
>2qh5_A PMI, ALGA, mannose-6-phosphate isomerase; structural genomics, PSI, protein structure initi nysgrc; 2.30A {Helicobacter pylori} Back     alignment and structure
>1w55_A ISPD/ISPF bifunctional enzyme; biosynthetic pathway, isoprenoids, nonmevalonate, transferase; HET: C GPP; 2.3A {Campylobacter jejuni} SCOP: c.68.1.13 d.79.5.1 PDB: 1w57_A* Back     alignment and structure
>2vsh_A TARI, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase; nucleotidyltransferase; HET: 1PE PG4 P6G; 2.00A {Streptococcus pneumoniae} PDB: 2vsi_A* Back     alignment and structure
>3pnn_A Conserved domain protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE GOL; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>2xwl_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran; transferase, MEP pathway; HET: CTP; 1.49A {Mycobacterium smegmatis} PDB: 2xwm_A* Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure
>2pa4_A UTP-glucose-1-phosphate uridylyltransferase; phosphorylase, nucleotidyltransferase, metabolism; HET: GUD; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2yc3_A 2-C-methyl-D-erythritol 4-phosphate cytidylyltran chloroplastic; transferase, non-mevalonate-pathway, herbicide, allosteric P; HET: MW5; 1.40A {Arabidopsis thaliana} PDB: 2yc5_A* 1w77_A* 2ycm_A* Back     alignment and structure
>3juk_A UDP-glucose pyrophosphorylase (GALU); transfer; HET: UPG; 2.30A {Helicobacter pylori} PDB: 3juj_A* Back     alignment and structure
>1hm9_A GLMU, UDP-N-acetylglucosamine-1-phosphate uridyltransfe; acetyltransferase, bifunctional, drug design; HET: ACO UD1; 1.75A {Streptococcus pneumoniae} SCOP: b.81.1.4 c.68.1.5 PDB: 1hm8_A* 1hm0_A* 4ac3_A* 4aaw_A* 1g97_A* 1g95_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 439
d1xhba2 328 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa 3e-33
d1xhba2328 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosa 4e-25
d2bo4a1 381 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MG 5e-10
d2bo4a1381 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MG 4e-04
d1omza_265 c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransf 2e-08
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  125 bits (314), Expect = 3e-33
 Identities = 87/191 (45%), Positives = 123/191 (64%), Gaps = 3/191 (1%)

Query: 248 DRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILV 307
           +R++PD+R+E CK   YP +LP  SV++VFHNE +S+L+RTVHS+I R+P   +EEI+LV
Sbjct: 1   NRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLV 60

Query: 308 DDFSSKADLDQKLEDYIQRFNGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEV 367
           DD S +  L + LE Y+++    V +IR  +R GLIR R +GA  SRG+VI FLDAHCE 
Sbjct: 61  DDASERDFLKRPLESYVKKLKVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCEC 120

Query: 368 GLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEPDHHYRGIFEWGMLYKENELP 427
              WL PLLA I  DR+ +  P+ID I   T+E+           G F W + ++   +P
Sbjct: 121 TAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYM---AGSDMTYGGFNWKLNFRWYPVP 177

Query: 428 EREAKKRKYNR 438
           +RE  +RK +R
Sbjct: 178 QREMDRRKGDR 188


>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 328 Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Length = 381 Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Length = 381 Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 265 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query439
d1xhba2 328 Polypeptide N-acetylgalactosaminyltransferase 1, N 99.97
d1xhba2328 Polypeptide N-acetylgalactosaminyltransferase 1, N 99.97
d1qg8a_255 Spore coat polysaccharide biosynthesis protein Sps 99.86
d1omza_265 Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga 99.78
d1qg8a_255 Spore coat polysaccharide biosynthesis protein Sps 99.61
d1omza_265 Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-Ga 99.21
d2bo4a1 381 Mannosylglycerate synthase, MGS {Rhodothermus mari 99.16
d1pzta_271 beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos 98.84
d2bo4a1381 Mannosylglycerate synthase, MGS {Rhodothermus mari 98.3
d1fo8a_ 343 N-acetylglucosaminyltransferase I {Rabbit (Oryctol 97.91
d1pzta_271 beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos 96.14
d1v82a_252 Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human ( 95.01
d3cu0a1261 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo 93.46
d1fxoa_ 292 RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} 92.96
d1mc3a_ 291 RffH {Escherichia coli [TaxId: 562]} 91.97
d1fo8a_343 N-acetylglucosaminyltransferase I {Rabbit (Oryctol 91.61
d1lvwa_ 295 RmlA (RfbA) {Archaeon Methanobacterium thermoautot 90.93
d1qwja_228 CMP acylneuraminate synthetase {Mouse (Mus musculu 87.95
d1w55a1205 IspD/IspF bifunctional enzyme, CDP-me synthase dom 83.58
d1w77a1226 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) 82.57
>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nucleotide-diphospho-sugar transferases
superfamily: Nucleotide-diphospho-sugar transferases
family: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
domain: Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.97  E-value=4.4e-31  Score=250.22  Aligned_cols=186  Identities=46%  Similarity=0.814  Sum_probs=169.3

Q ss_pred             CCCCCcccccccccccCCCCCCceEEEEEecCCChhHHHHHHHHHHhcCCcCCcceEEEEeCCCChhhHHHHHHHHHHHc
Q psy8674         248 DRTIPDLRMEECKYWDYPLDLPKASVILVFHNEGFSSLMRTVHSIIKRTPAQYLEEIILVDDFSSKADLDQKLEDYIQRF  327 (439)
Q Consensus       248 ~~~~~~~~~~~~~~~~~~~~~p~vsiiip~~n~~~~~l~~~l~sl~~q~~~~~~~eiivvdd~s~d~t~~~~~~~~~~~~  327 (439)
                      +|.+||.|+..|....++..+|.||||||+||+..+.|.+||+|+++|+++....|||||||||+|+|..+.++++.+..
T Consensus         1 ~~~~~~~r~~~~~~~~~~~~~P~vSIIIp~yNe~~~~l~~~l~Si~~qt~~~~~~EIIvVDdgS~d~~~~~~l~~~~~~~   80 (328)
T d1xhba2           1 NRSLPDVRLEGCKTKVYPDNLPTTSVVIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKL   80 (328)
T ss_dssp             CCCCCCCSCGGGGTCCCCSCCCCEEEEEEESSCCHHHHHHHHHHHHHSSCGGGEEEEEEEECSCCCGGGTHHHHHHHHSS
T ss_pred             CCCCCCCCChhhhhccCCCCCCCEEEEEeccCCcHHHHHHHHHHHHhcCCCCCCeEEEEEECCCChhhHHHHHHHHHHhc
Confidence            47899999999999999999999999999999873579999999999998876679999999999998876888888887


Q ss_pred             CCcEEEEEcCCCCCHHHHHHHHHhhcCCCEEEEEcCCCccCCCChHHHHHhhhcCCCEEEEeeeeeecCCCceEEeecCC
Q psy8674         328 NGKVRLIRNTEREGLIRTRSRGAKESRGEVIVFLDAHCEVGLNWLPPLLAPIYSDRKIMTVPVIDGIDYQTWEFRSVYEP  407 (439)
Q Consensus       328 ~~~v~~i~~~~~~g~~~a~n~g~~~a~~d~i~~ld~D~~~~~~~l~~l~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~  407 (439)
                      +.+++++++++|.|.+.|+|.|++.|+|+||+|||+|+.+.|+||+.+++.+.+++..+++|.++.++.+++.|...   
T Consensus        81 ~~~i~vi~~~~n~G~~~a~N~Gi~~a~gd~i~flD~D~~~~p~~l~~l~~~~~~~~~~~v~~~~~~i~~~~~~~~~~---  157 (328)
T d1xhba2          81 KVPVHVIRMEQRSGLIRARLKGAAVSRGQVITFLDAHCECTAGWLEPLLARIKHDRRTVVCPIIDVISDDTFEYMAG---  157 (328)
T ss_dssp             SSCEEEEECSSCCCHHHHHHHHHHHCCSSEEEEEESSEEECTTCHHHHHHHHHHCTTEEEEEEEEEECSSSCCEECC---
T ss_pred             CCCeEEEEecccccchHHHHHHHHhhhcceeeecCcccccChhHHHHHHHHHhcCCCeEEecceeeeccCceeeccC---
Confidence            77899999999999999999999999999999999999999999999999999999999999999999999998854   


Q ss_pred             CCCceeeeeccceeEeecCCHHHHhhccC
Q psy8674         408 DHHYRGIFEWGMLYKENELPEREAKKRKY  436 (439)
Q Consensus       408 ~~~~~g~~~w~~~~~~~~~~~~~~~~~~~  436 (439)
                      ....++.|+|.+.+.+..++..++.....
T Consensus       158 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  186 (328)
T d1xhba2         158 SDMTYGGFNWKLNFRWYPVPQREMDRRKG  186 (328)
T ss_dssp             CTTEEEEECTTCCEEEEECCHHHHHHTTT
T ss_pred             Cccccccccccccccccccchhhhhcccc
Confidence            34567999999999999999998776543



>d1xhba2 c.68.1.17 (A:95-422) Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg8a_ c.68.1.1 (A:) Spore coat polysaccharide biosynthesis protein SpsA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1omza_ c.68.1.15 (A:) Alpha-1,4-N-acetylhexosaminyltransferase (Alpha-GalNAcT EXTL2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bo4a1 c.68.1.18 (A:2-382) Mannosylglycerate synthase, MGS {Rhodothermus marinus [TaxId: 29549]} Back     information, alignment and structure
>d1fo8a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pzta_ c.68.1.2 (A:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1v82a_ c.68.1.7 (A:) Beta-1,3-glucuronyltransferase 1, GlcAT-P {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cu0a1 c.68.1.7 (A:75-335) 1,3-Glucuronyltransferase I (glcAT-I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxoa_ c.68.1.6 (A:) RmlA (RfbA) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mc3a_ c.68.1.6 (A:) RffH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fo8a_ c.68.1.10 (A:) N-acetylglucosaminyltransferase I {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1lvwa_ c.68.1.6 (A:) RmlA (RfbA) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1qwja_ c.68.1.13 (A:) CMP acylneuraminate synthetase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1w55a1 c.68.1.13 (A:3-207) IspD/IspF bifunctional enzyme, CDP-me synthase domain {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1w77a1 c.68.1.13 (A:75-300) 4-diphosphocytidyl-2C-methyl-D-erythritol (CDP-me) synthase (IspD, YgbP) {Thale cress (Arabidopsis thaliana), chloroplast [TaxId: 3702]} Back     information, alignment and structure