Diaphorina citri psyllid: psy8690


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220--
MAAVEMEDIKPKLKDLPKFHNDSSSDSSSSDSDDDNSDSSVSTSSSVDHKGRSVEVKKARSAEKVTARPEKPTIRTYDYITKINYLFRDARFFVIKSNNSENVDIAKGQGVWSTLPQNEQKLNQAYRESRNVLLIFSVRESGKFSGFARLASEADHGVSPVKWVLPPGLSGKVLNGVFKIDWVSRKELPFTSTLHLYNSWNEGYPGSGVPPDPAALFDYMRS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccHHHHHHHHcccEEEccccHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHccccccccccccccccccccccccccCEEEEEEEEEcccccccccccccccccccccccccHHHHHcccccc
************************************************************************TIRTYDYITKINYLFRDARFFVIKSNNSENVDIAKGQGVWSTLPQNEQKLNQAYRESRNVLLIFSVRESGKFSGFARLASEADHGVSPVKWVLPPGLSGKVLNGVFKIDWVSRKELPFTSTLHLYNSWNEGYPGSGVPPDPAALFDYMRS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAVEMEDIKPKLKDLPKFHNDSSSDSSSSDSDDDNSDSSVSTSSSVDHKGRSVEVKKARSAEKVTARPEKPTIRTYDYITKINYLFRDARFFVIKSNNSENVDIAKGQGVWSTLPQNEQKLNQAYRESRNVLLIFSVRESGKFSGFARLASEADHGVSPVKWVLPPGLSGKVLNGVFKIDWVSRKELPFTSTLHLYNSWNEGYPGSGVPPDPAALFDYMRS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
YTH domain-containing protein 1 May be part of a signal transduction pathway that influences splice site selection.confidentQ9QY02
YTH domain-containing protein 1 May be part of a signal transduction pathway that influences splice site selection.confidentQ96MU7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0000398 [BP]mRNA splicing, via spliceosomeprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0044237, GO:0043170, GO:0006396, GO:0006397
GO:0016604 [CC]nuclear bodyprobableGO:0044446, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YUD, chain A
Confidence level:very confident
Coverage over the Query: 78-218
View the alignment between query and template
View the model in PyMOL