Diaphorina citri psyllid: psy8709

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32

MSVEEMKQCVASRLDSMDMHADSDDNDASVKDCYQRNWYKQAVTSVIVRSVILVLSVTIMSPPACSDLEEKNAEIDMRNEDIAQMRHLMQDMLNKKEEDEEGENKTRRHDKYYFNSYEDAHIHAEMIKDTVRTESYKSAILNNNSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSGTPIRTESYKSAILNNKSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSDIAYETIDIIRKNKYDSQIEVYHKLLEDVELPVESVDIIISEWMGYFLLFETMIDSVIDARNRFLKPDGVVCPNRFTLSLCGAYAE

ccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHccccHHHHHHHHHccccccccccEEEcccccccHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHccccccEEEEEEcccccccccccccEEEEcccccccccHHHHHHHHHHHHHccccccEEEccccEEEEEEECcc

*************LDSMDMHADSDDNDASVKDCYQRNWYKQAVTSVIVRSVILVLSVTIMS*************************************************KYYFNSYEDAHIHAEMIKDTVRTESYKSAILNNNSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSGTPIRTESYKSAILNNKSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSDIAYETIDIIRKNKYDSQIEVYHKLLEDVELPVESVDIIISEWMGYFLLFETMIDSVIDARNRFLKPDGVVCPNRFTLSLCGAYAE

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Protein arginine N-methyltransferase 3	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.	confident	Q922H1
Probable protein arginine N-methyltransferase 6	Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and asymmetrical dimethylarginine (aDMA).	confident	Q08A71
Protein arginine N-methyltransferase 3	Methylates (mono and asymmetric dimethylation) the guanidino nitrogens of arginyl residues in some proteins.	confident	O70467

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005488 [MF]	binding	probable	GO:0003674
GO:0019919 [BP]	peptidyl-arginine methylation, to asymmetrical-dimethyl arginine	probable	GO:0006479, GO:0008213, GO:0035246, GO:0035247, GO:0044267, GO:0044260, GO:0018216, GO:0018193, GO:0071704, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044238, GO:0019538, GO:0044237, GO:0043170, GO:0018195, GO:0043414
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0043232 [CC]	intracellular non-membrane-bounded organelle	probable	GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0035241 [MF]	protein-arginine omega-N monomethyltransferase activity	probable	GO:0016274, GO:0016273, GO:0003824, GO:0008757, GO:0016740, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0035242 [MF]	protein-arginine omega-N asymmetric methyltransferase activity	probable	GO:0016274, GO:0016273, GO:0003824, GO:0008757, GO:0016740, GO:0016741, GO:0008170, GO:0008276, GO:0003674, GO:0008168
GO:0034969 [BP]	histone arginine methylation	probable	GO:0006479, GO:0008213, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016571, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044763, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0031981 [CC]	nuclear lumen	probable	GO:0005575, GO:0043231, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0044020 [MF]	histone methyltransferase activity (H4-R3 specific)	probable	GO:0016274, GO:0042054, GO:0016273, GO:0003824, GO:0008757, GO:0016740, GO:0016741, GO:0008469, GO:0008170, GO:0008276, GO:0003674, GO:0008168

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FYT, chain A
Confidence level:very confident
Coverage over the Query: 114-149,203-317
View the alignment between query and template
View the model in PyMOL

Template: 2YXD, chain A
Confidence level:very confident
Coverage over the Query: 183-311
View the alignment between query and template
View the model in PyMOL

Template: 3BZB, chain A
Confidence level:confident
Coverage over the Query: 133-183
View the alignment between query and template
View the model in PyMOL

Template: 3FPF, chain A
Confidence level:probable
Coverage over the Query: 8-186
View the alignment between query and template
View the model in PyMOL