Psyllid ID: psy8709
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 319 | ||||||
| 194767701 | 520 | GF11802 [Drosophila ananassae] gi|190619 | 0.623 | 0.382 | 0.386 | 1e-38 | |
| 91080947 | 505 | PREDICTED: similar to arginine n-methylt | 0.611 | 0.386 | 0.377 | 2e-38 | |
| 195501408 | 516 | GE26400 [Drosophila yakuba] gi|194183884 | 0.623 | 0.385 | 0.378 | 7e-38 | |
| 195328821 | 516 | GM25795 [Drosophila sechellia] gi|194120 | 0.623 | 0.385 | 0.375 | 3e-37 | |
| 194900938 | 517 | GG20792 [Drosophila erecta] gi|190651715 | 0.623 | 0.384 | 0.378 | 3e-37 | |
| 195570740 | 477 | GD20372 [Drosophila simulans] gi|1941992 | 0.623 | 0.417 | 0.375 | 3e-37 | |
| 45360587 | 519 | protein arginine methyltransferase 3 [Xe | 0.567 | 0.348 | 0.390 | 5e-37 | |
| 260825710 | 521 | hypothetical protein BRAFLDRAFT_117306 [ | 0.407 | 0.249 | 0.553 | 5e-37 | |
| 405962860 | 540 | Protein arginine N-methyltransferase 3 [ | 0.407 | 0.240 | 0.553 | 6e-37 | |
| 148233213 | 519 | protein arginine methyltransferase 3 [Xe | 0.539 | 0.331 | 0.385 | 2e-36 |
| >gi|194767701|ref|XP_001965953.1| GF11802 [Drosophila ananassae] gi|190619796|gb|EDV35320.1| GF11802 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
Score = 166 bits (420), Expect = 1e-38, Method: Compositional matrix adjust.
Identities = 102/264 (38%), Positives = 138/264 (52%), Gaps = 65/264 (24%)
Query: 63 PACSDLEEKNAE----IDMRNEDIAQMRHLMQDMLNK----KEEDEEGENKTRRH---DK 111
P+ +L ++ AE + NED+ +MR +++L K KE G+ R + DK
Sbjct: 151 PSVPELLQQIAEQAKLLQQANEDMERMRSDYKELLQKVHGDKESKPAGDAVPRNNPNWDK 210
Query: 112 YYFNSYEDAHIHAEMIKDTVRTESYKSAILNNNSLFNNKHVIDVGAGTGILSIFAAQAGA 171
YFNSY IH EM+ D VRT +Y+SA+L N + N K V+DVG GTGILSIFA+QAGA
Sbjct: 211 EYFNSYSHFGIHHEMLSDKVRTSTYRSALLENKAAVNGKAVLDVGCGTGILSIFASQAGA 270
Query: 172 AKVFAIEKSGTPIRTESYKSAILNNKSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIE 231
A+V I+ S
Sbjct: 271 ARVVGIDNS--------------------------------------------------- 279
Query: 232 KSDIAYETIDIIRKNKYDSQIEVYHKLLEDVELPVESVDIIISEWMGYFLLFETMIDSVI 291
DI Y +DI+RKNK + +++ LED ELP DIIISEWMGYFLL+E+M+DS+I
Sbjct: 280 --DIVYTAMDIVRKNKVQN-VQLVKGRLEDTELPEAKYDIIISEWMGYFLLYESMLDSII 336
Query: 292 DARNRFLKPDGVVCPNRFTLSLCG 315
AR L P+G++ P+R TLS+ G
Sbjct: 337 YAREHHLNPNGIILPSRCTLSILG 360
|
Source: Drosophila ananassae Species: Drosophila ananassae Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|91080947|ref|XP_974375.1| PREDICTED: similar to arginine n-methyltransferase [Tribolium castaneum] gi|270005950|gb|EFA02398.1| hypothetical protein TcasGA2_TC008078 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|195501408|ref|XP_002097783.1| GE26400 [Drosophila yakuba] gi|194183884|gb|EDW97495.1| GE26400 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
| >gi|195328821|ref|XP_002031110.1| GM25795 [Drosophila sechellia] gi|194120053|gb|EDW42096.1| GM25795 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|194900938|ref|XP_001980012.1| GG20792 [Drosophila erecta] gi|190651715|gb|EDV48970.1| GG20792 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195570740|ref|XP_002103362.1| GD20372 [Drosophila simulans] gi|194199289|gb|EDX12865.1| GD20372 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
| >gi|45360587|ref|NP_988966.1| protein arginine methyltransferase 3 [Xenopus (Silurana) tropicalis] gi|38174441|gb|AAH61427.1| heterogeneous nuclear ribonucleoprotein methyltransferase-like 3 (S. cerevisiae) [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|260825710|ref|XP_002607809.1| hypothetical protein BRAFLDRAFT_117306 [Branchiostoma floridae] gi|229293158|gb|EEN63819.1| hypothetical protein BRAFLDRAFT_117306 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|405962860|gb|EKC28501.1| Protein arginine N-methyltransferase 3 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|148233213|ref|NP_001090360.1| protein arginine methyltransferase 3 [Xenopus laevis] gi|114108185|gb|AAI23236.1| MGC154481 protein [Xenopus laevis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 319 | ||||||
| FB|FBgn0038306 | 516 | Art3 "Arginine methyltransfera | 0.410 | 0.253 | 0.5 | 5.1e-31 | |
| ZFIN|ZDB-GENE-041105-1 | 512 | prmt3 "protein arginine methyl | 0.407 | 0.253 | 0.476 | 6.9e-30 | |
| UNIPROTKB|O60678 | 531 | PRMT3 "Protein arginine N-meth | 0.407 | 0.244 | 0.5 | 2e-29 | |
| UNIPROTKB|A6QL80 | 527 | PRMT3 "PRMT3 protein" [Bos tau | 0.407 | 0.246 | 0.484 | 3.2e-29 | |
| UNIPROTKB|F1P8W2 | 454 | PRMT3 "Uncharacterized protein | 0.407 | 0.286 | 0.484 | 3.4e-29 | |
| TAIR|locus:2051995 | 366 | PRMT1A "protein arginine methy | 0.401 | 0.349 | 0.453 | 3.7e-29 | |
| UNIPROTKB|F1NYG2 | 513 | PRMT3 "Uncharacterized protein | 0.407 | 0.253 | 0.484 | 4.5e-29 | |
| POMBASE|SPAC890.07c | 340 | rmt1 "type I protein arginine | 0.407 | 0.382 | 0.453 | 5.6e-29 | |
| RGD|620413 | 528 | Prmt3 "protein arginine methyl | 0.407 | 0.246 | 0.484 | 9e-29 | |
| UNIPROTKB|O70467 | 528 | Prmt3 "Protein arginine N-meth | 0.407 | 0.246 | 0.484 | 9e-29 |
| FB|FBgn0038306 Art3 "Arginine methyltransferase 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 343 (125.8 bits), Expect = 5.1e-31, P = 5.1e-31
Identities = 66/132 (50%), Positives = 91/132 (68%)
Query: 184 IRTESYKSAILNNKSLFNNKHVIDVGAGTGILSIFXXXXXXXXXXXIEKSDIAYETIDII 243
+RT +Y++++L N+++ K V+DVG GTGILSIF I+ SDI Y +DII
Sbjct: 226 VRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAMDII 285
Query: 244 RKNKYDSQIEVYHKLLEDVELPVESVDIIISEWMGYFLLFETMIDSVIDARNRFLKPDGV 303
RKNK ++ +E+ LED +LP DIIISEWMGYFLL+E+M+DS+I AR L P+G+
Sbjct: 286 RKNKVEN-VELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGI 344
Query: 304 VCPNRFTLSLCG 315
+ P+R TLSL G
Sbjct: 345 ILPSRCTLSLLG 356
|
|
| ZFIN|ZDB-GENE-041105-1 prmt3 "protein arginine methyltransferase 3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O60678 PRMT3 "Protein arginine N-methyltransferase 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QL80 PRMT3 "PRMT3 protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P8W2 PRMT3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2051995 PRMT1A "protein arginine methyltransferase 1A" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NYG2 PRMT3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPAC890.07c rmt1 "type I protein arginine N-methyltransferase Rmt1" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| RGD|620413 Prmt3 "protein arginine methyltransferase 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O70467 Prmt3 "Protein arginine N-methyltransferase 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 319 | |||
| cd02440 | 107 | cd02440, AdoMet_MTases, S-adenosylmethionine-depen | 1e-13 | |
| pfam06325 | 294 | pfam06325, PrmA, Ribosomal protein L11 methyltrans | 3e-10 | |
| pfam12847 | 104 | pfam12847, Methyltransf_18, Methyltransferase doma | 1e-09 | |
| pfam13659 | 117 | pfam13659, Methyltransf_26, Methyltransferase doma | 1e-07 | |
| COG4076 | 252 | COG4076, COG4076, Predicted RNA methylase [General | 1e-07 | |
| PRK00517 | 250 | PRK00517, prmA, ribosomal protein L11 methyltransf | 3e-07 | |
| COG2264 | 300 | COG2264, PrmA, Ribosomal protein L11 methylase [Tr | 5e-07 | |
| pfam08241 | 92 | pfam08241, Methyltransf_11, Methyltransferase doma | 9e-07 | |
| COG2263 | 198 | COG2263, COG2263, Predicted RNA methylase [Transla | 1e-06 | |
| pfam05185 | 445 | pfam05185, PRMT5, PRMT5 arginine-N-methyltransfera | 2e-06 | |
| COG2227 | 243 | COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-m | 2e-06 | |
| PRK08287 | 187 | PRK08287, PRK08287, cobalt-precorrin-6Y C(15)-meth | 4e-06 | |
| PRK00517 | 250 | PRK00517, prmA, ribosomal protein L11 methyltransf | 6e-06 | |
| pfam13649 | 97 | pfam13649, Methyltransf_25, Methyltransferase doma | 7e-06 | |
| COG0742 | 187 | COG0742, COG0742, N6-adenine-specific methylase [D | 8e-06 | |
| COG2242 | 187 | COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme | 9e-06 | |
| PRK14968 | 188 | PRK14968, PRK14968, putative methyltransferase; Pr | 1e-05 | |
| COG2890 | 280 | COG2890, HemK, Methylase of polypeptide chain rele | 1e-05 | |
| pfam03602 | 183 | pfam03602, Cons_hypoth95, Conserved hypothetical p | 2e-05 | |
| PRK09328 | 275 | PRK09328, PRK09328, N5-glutamine S-adenosyl-L-meth | 2e-05 | |
| TIGR00406 | 288 | TIGR00406, prmA, ribosomal protein L11 methyltrans | 2e-05 | |
| TIGR02072 | 240 | TIGR02072, BioC, biotin biosynthesis protein BioC | 3e-05 | |
| COG4123 | 248 | COG4123, COG4123, Predicted O-methyltransferase [G | 5e-05 | |
| pfam13847 | 151 | pfam13847, Methyltransf_31, Methyltransferase doma | 6e-05 | |
| COG2264 | 300 | COG2264, PrmA, Ribosomal protein L11 methylase [Tr | 1e-04 | |
| COG2520 | 341 | COG2520, COG2520, Predicted methyltransferase [Gen | 1e-04 | |
| pfam06325 | 294 | pfam06325, PrmA, Ribosomal protein L11 methyltrans | 2e-04 | |
| pfam12847 | 104 | pfam12847, Methyltransf_18, Methyltransferase doma | 2e-04 | |
| COG2263 | 198 | COG2263, COG2263, Predicted RNA methylase [Transla | 2e-04 | |
| PRK08287 | 187 | PRK08287, PRK08287, cobalt-precorrin-6Y C(15)-meth | 2e-04 | |
| COG2230 | 283 | COG2230, Cfa, Cyclopropane fatty acid synthase and | 2e-04 | |
| TIGR02469 | 124 | TIGR02469, CbiT, precorrin-6Y C5,15-methyltransfer | 4e-04 | |
| COG2242 | 187 | COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme | 5e-04 | |
| TIGR00406 | 288 | TIGR00406, prmA, ribosomal protein L11 methyltrans | 8e-04 | |
| COG4076 | 252 | COG4076, COG4076, Predicted RNA methylase [General | 0.001 | |
| COG0742 | 187 | COG0742, COG0742, N6-adenine-specific methylase [D | 0.001 | |
| COG3897 | 218 | COG3897, COG3897, Predicted methyltransferase [Gen | 0.001 | |
| pfam03602 | 183 | pfam03602, Cons_hypoth95, Conserved hypothetical p | 0.002 | |
| pfam08242 | 98 | pfam08242, Methyltransf_12, Methyltransferase doma | 0.002 | |
| pfam05175 | 170 | pfam05175, MTS, Methyltransferase small domain | 0.002 | |
| COG2226 | 238 | COG2226, UbiE, Methylase involved in ubiquinone/me | 0.002 | |
| TIGR00095 | 190 | TIGR00095, TIGR00095, RNA methyltransferase, RsmD | 0.002 | |
| COG2813 | 300 | COG2813, RsmC, 16S RNA G1207 methylase RsmC [Trans | 0.002 | |
| pfam13489 | 154 | pfam13489, Methyltransf_23, Methyltransferase doma | 0.002 | |
| PRK14967 | 223 | PRK14967, PRK14967, putative methyltransferase; Pr | 0.003 | |
| PRK14967 | 223 | PRK14967, PRK14967, putative methyltransferase; Pr | 0.003 | |
| TIGR01444 | 144 | TIGR01444, fkbM_fam, methyltransferase, FkbM famil | 0.003 | |
| TIGR01444 | 144 | TIGR01444, fkbM_fam, methyltransferase, FkbM famil | 0.004 |
| >gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
Score = 65.5 bits (160), Expect = 1e-13
Identities = 29/101 (28%), Positives = 47/101 (46%), Gaps = 3/101 (2%)
Query: 205 VIDVGAGTGILSIFAAQAGAAKVFAIEKSDIAYETIDIIRKNKYDSQIEVYH-KLLEDVE 263
V+D+G GTG L++ A A+V ++ S +A E +EV E
Sbjct: 2 VLDLGCGTGALALALASGPGARVTGVDISPVALELARKAAAALLADNVEVLKGDAEELPP 61
Query: 264 LPVESVDIIISEWMGYFLLFETMIDSVIDARNRFLKPDGVV 304
ES D+IIS+ + L+ + + ++ R LKP GV+
Sbjct: 62 EADESFDVIISDPPLHHLVED--LARFLEEARRLLKPGGVL 100
|
There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.). Length = 107 |
| >gnl|CDD|218990 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) | Back alignment and domain information |
|---|
| >gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|226562 COG4076, COG4076, Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|234786 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|225173 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|219759 pfam08241, Methyltransf_11, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|225172 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|218484 pfam05185, PRMT5, PRMT5 arginine-N-methyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|225137 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|181354 PRK08287, PRK08287, cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|234786 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|222287 pfam13649, Methyltransf_25, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|223813 COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|237872 PRK14968, PRK14968, putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225443 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|202698 pfam03602, Cons_hypoth95, Conserved hypothetical protein 95 | Back alignment and domain information |
|---|
| >gnl|CDD|236467 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|232960 TIGR00406, prmA, ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233708 TIGR02072, BioC, biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >gnl|CDD|226608 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|225173 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|225318 COG2520, COG2520, Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|218990 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) | Back alignment and domain information |
|---|
| >gnl|CDD|221804 pfam12847, Methyltransf_18, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|225172 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|181354 PRK08287, PRK08287, cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|225139 COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|233880 TIGR02469, CbiT, precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >gnl|CDD|225151 COG2242, CobL, Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|232960 TIGR00406, prmA, ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|226562 COG4076, COG4076, Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223813 COG0742, COG0742, N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|226413 COG3897, COG3897, Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|202698 pfam03602, Cons_hypoth95, Conserved hypothetical protein 95 | Back alignment and domain information |
|---|
| >gnl|CDD|219760 pfam08242, Methyltransf_12, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|203189 pfam05175, MTS, Methyltransferase small domain | Back alignment and domain information |
|---|
| >gnl|CDD|225136 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188022 TIGR00095, TIGR00095, RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >gnl|CDD|225370 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|222171 pfam13489, Methyltransf_23, Methyltransferase domain | Back alignment and domain information |
|---|
| >gnl|CDD|184931 PRK14967, PRK14967, putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184931 PRK14967, PRK14967, putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233415 TIGR01444, fkbM_fam, methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >gnl|CDD|233415 TIGR01444, fkbM_fam, methyltransferase, FkbM family | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 319 | |||
| KOG1499|consensus | 346 | 99.97 | ||
| KOG1500|consensus | 517 | 99.93 | ||
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 99.78 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 99.77 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 99.74 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 99.73 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 99.69 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 99.68 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 99.67 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 99.67 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 99.67 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 99.66 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 99.65 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 99.64 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 99.64 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 99.64 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 99.64 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 99.63 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 99.63 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 99.62 | |
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 99.6 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 99.6 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 99.6 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 99.6 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 99.59 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 99.58 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 99.58 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 99.57 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 99.57 | |
| KOG1540|consensus | 296 | 99.56 | ||
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 99.56 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 99.56 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 99.55 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 99.55 | |
| KOG1270|consensus | 282 | 99.54 | ||
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 99.54 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 99.54 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 99.54 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 99.53 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 99.53 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 99.52 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 99.52 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 99.52 | |
| PF05401 | 201 | NodS: Nodulation protein S (NodS); InterPro: IPR00 | 99.52 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 99.52 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 99.52 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 99.52 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 99.51 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 99.51 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 99.5 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 99.5 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 99.5 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 99.5 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 99.5 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 99.49 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 99.48 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 99.48 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 99.47 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 99.47 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 99.46 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 99.46 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 99.46 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 99.45 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 99.45 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 99.45 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 99.45 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 99.45 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 99.45 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 99.45 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 99.44 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 99.44 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 99.43 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 99.43 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 99.43 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 99.43 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 99.43 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 99.43 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 99.43 | |
| KOG1271|consensus | 227 | 99.43 | ||
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 99.43 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 99.42 | |
| KOG4300|consensus | 252 | 99.41 | ||
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 99.41 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 99.41 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 99.4 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 99.39 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 99.39 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 99.38 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 99.38 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 99.38 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 99.37 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 99.37 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 99.37 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 99.37 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 99.37 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 99.36 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 99.36 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 99.35 | |
| TIGR01983 | 224 | UbiG ubiquinone biosynthesis O-methyltransferase. | 99.35 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 99.35 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 99.34 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 99.34 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 99.34 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 99.33 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 99.33 | |
| PRK04266 | 226 | fibrillarin; Provisional | 99.32 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 99.32 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 99.32 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 99.32 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 99.31 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 99.31 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 99.3 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 99.3 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 99.28 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 99.28 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 99.27 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 99.25 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 99.25 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 99.24 | |
| KOG2904|consensus | 328 | 99.23 | ||
| PHA03412 | 241 | putative methyltransferase; Provisional | 99.22 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 99.22 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 99.22 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 99.22 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 99.21 | |
| KOG1501|consensus | 636 | 99.21 | ||
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 99.2 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 99.19 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 99.19 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 99.19 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 99.17 | |
| KOG2899|consensus | 288 | 99.17 | ||
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 99.16 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 99.16 | |
| COG1092 | 393 | Predicted SAM-dependent methyltransferases [Genera | 99.16 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 99.15 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 99.15 | |
| PF10672 | 286 | Methyltrans_SAM: S-adenosylmethionine-dependent me | 99.14 | |
| COG1041 | 347 | Predicted DNA modification methylase [DNA replicat | 99.12 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 99.11 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 99.1 | |
| PLN02476 | 278 | O-methyltransferase | 99.09 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 99.08 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 99.07 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 99.07 | |
| KOG1975|consensus | 389 | 99.07 | ||
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 99.06 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 99.05 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 99.05 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 99.05 | |
| KOG1541|consensus | 270 | 99.05 | ||
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 99.04 | |
| KOG3010|consensus | 261 | 99.04 | ||
| PRK13256 | 226 | thiopurine S-methyltransferase; Reviewed | 99.04 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 99.02 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 99.02 | |
| PLN02366 | 308 | spermidine synthase | 99.01 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 99.01 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 99.0 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 98.97 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 98.97 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 98.96 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.95 | |
| PF05724 | 218 | TPMT: Thiopurine S-methyltransferase (TPMT); Inter | 98.93 | |
| PLN02232 | 160 | ubiquinone biosynthesis methyltransferase | 98.93 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 98.92 | |
| PF05891 | 218 | Methyltransf_PK: AdoMet dependent proline di-methy | 98.92 | |
| PRK01581 | 374 | speE spermidine synthase; Validated | 98.92 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 98.9 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 98.89 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 98.87 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 98.85 | |
| PF00891 | 241 | Methyltransf_2: O-methyltransferase; InterPro: IPR | 98.84 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 98.82 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 98.82 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 98.81 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 98.8 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 98.8 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 98.79 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 98.78 | |
| KOG2361|consensus | 264 | 98.7 | ||
| KOG3191|consensus | 209 | 98.69 | ||
| COG3963 | 194 | Phospholipid N-methyltransferase [Lipid metabolism | 98.69 | |
| KOG0820|consensus | 315 | 98.68 | ||
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 98.68 | |
| KOG3420|consensus | 185 | 98.67 | ||
| KOG2940|consensus | 325 | 98.64 | ||
| PF05148 | 219 | Methyltransf_8: Hypothetical methyltransferase; In | 98.62 | |
| PF02527 | 184 | GidB: rRNA small subunit methyltransferase G; Inte | 98.62 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 98.61 | |
| PLN02823 | 336 | spermine synthase | 98.6 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 98.59 | |
| PF06080 | 204 | DUF938: Protein of unknown function (DUF938); Inte | 98.58 | |
| PF01739 | 196 | CheR: CheR methyltransferase, SAM binding domain; | 98.56 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 98.56 | |
| KOG1661|consensus | 237 | 98.56 | ||
| PF12147 | 311 | Methyltransf_20: Putative methyltransferase; Inter | 98.55 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 98.54 | |
| KOG3045|consensus | 325 | 98.52 | ||
| PF02384 | 311 | N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T | 98.51 | |
| KOG1663|consensus | 237 | 98.51 | ||
| TIGR00308 | 374 | TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi | 98.5 | |
| PRK10611 | 287 | chemotaxis methyltransferase CheR; Provisional | 98.5 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 98.5 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 98.5 | |
| PF05219 | 265 | DREV: DREV methyltransferase; InterPro: IPR007884 | 98.5 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 98.48 | |
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 98.46 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 98.44 | |
| COG0421 | 282 | SpeE Spermidine synthase [Amino acid transport and | 98.44 | |
| PRK00536 | 262 | speE spermidine synthase; Provisional | 98.43 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 98.41 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 98.36 | |
| KOG2915|consensus | 314 | 98.35 | ||
| COG3897 | 218 | Predicted methyltransferase [General function pred | 98.33 | |
| COG1352 | 268 | CheR Methylase of chemotaxis methyl-accepting prot | 98.3 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 98.29 | |
| KOG0822|consensus | 649 | 98.26 | ||
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 98.25 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 98.24 | |
| PF07942 | 270 | N2227: N2227-like protein; InterPro: IPR012901 Thi | 98.23 | |
| COG0357 | 215 | GidB Predicted S-adenosylmethionine-dependent meth | 98.22 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 98.22 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 98.22 | |
| KOG2187|consensus | 534 | 98.21 | ||
| PF04816 | 205 | DUF633: Family of unknown function (DUF633) ; Inte | 98.2 | |
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 98.19 | |
| PF01728 | 181 | FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 | 98.15 | |
| KOG2730|consensus | 263 | 98.15 | ||
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 98.15 | |
| COG0500 | 257 | SmtA SAM-dependent methyltransferases [Secondary m | 98.13 | |
| PF13578 | 106 | Methyltransf_24: Methyltransferase domain; PDB: 3S | 98.08 | |
| KOG1331|consensus | 293 | 98.06 | ||
| COG0293 | 205 | FtsJ 23S rRNA methylase [Translation, ribosomal st | 98.05 | |
| PRK11760 | 357 | putative 23S rRNA C2498 ribose 2'-O-ribose methylt | 98.02 | |
| KOG1122|consensus | 460 | 98.02 | ||
| KOG1269|consensus | 364 | 98.02 | ||
| KOG3178|consensus | 342 | 98.0 | ||
| PF05971 | 299 | Methyltransf_10: Protein of unknown function (DUF8 | 97.98 | |
| KOG1709|consensus | 271 | 97.95 | ||
| PF03059 | 276 | NAS: Nicotianamine synthase protein; InterPro: IPR | 97.95 | |
| PF01269 | 229 | Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr | 97.95 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 97.87 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 97.87 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 97.83 | |
| PF11968 | 219 | DUF3321: Putative methyltransferase (DUF3321); Int | 97.82 | |
| PF09243 | 274 | Rsm22: Mitochondrial small ribosomal subunit Rsm22 | 97.81 | |
| COG4262 | 508 | Predicted spermidine synthase with an N-terminal m | 97.8 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 97.8 | |
| PF04672 | 267 | Methyltransf_19: S-adenosyl methyltransferase; Int | 97.76 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 97.75 | |
| COG1189 | 245 | Predicted rRNA methylase [Translation, ribosomal s | 97.74 | |
| PTZ00357 | 1072 | methyltransferase; Provisional | 97.67 | |
| COG2384 | 226 | Predicted SAM-dependent methyltransferase [General | 97.65 | |
| KOG4058|consensus | 199 | 97.51 | ||
| COG1889 | 231 | NOP1 Fibrillarin-like rRNA methylase [Translation, | 97.51 | |
| KOG3201|consensus | 201 | 97.47 | ||
| KOG4589|consensus | 232 | 97.45 | ||
| PF01234 | 256 | NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I | 97.45 | |
| PF06962 | 140 | rRNA_methylase: Putative rRNA methylase; InterPro: | 97.44 | |
| KOG2352|consensus | 482 | 97.39 | ||
| PF04445 | 234 | SAM_MT: Putative SAM-dependent methyltransferase; | 97.36 | |
| TIGR00006 | 305 | S-adenosyl-methyltransferase MraW. Genetics paper | 97.32 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 97.31 | |
| KOG1499|consensus | 346 | 97.28 | ||
| KOG2899|consensus | 288 | 97.22 | ||
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 97.2 | |
| COG2227 | 243 | UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- | 97.18 | |
| KOG2671|consensus | 421 | 97.17 | ||
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 97.16 | |
| PF02005 | 377 | TRM: N2,N2-dimethylguanosine tRNA methyltransferas | 97.12 | |
| KOG2798|consensus | 369 | 97.08 | ||
| COG4798 | 238 | Predicted methyltransferase [General function pred | 97.05 | |
| KOG1500|consensus | 517 | 97.01 | ||
| KOG2198|consensus | 375 | 96.93 | ||
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 96.92 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 96.91 | |
| PF01861 | 243 | DUF43: Protein of unknown function DUF43; InterPro | 96.9 | |
| PHA01634 | 156 | hypothetical protein | 96.85 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 96.85 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 96.85 | |
| KOG1270|consensus | 282 | 96.81 | ||
| PF08003 | 315 | Methyltransf_9: Protein of unknown function (DUF16 | 96.76 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 96.76 | |
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 96.74 | |
| KOG3987|consensus | 288 | 96.73 | ||
| PF03141 | 506 | Methyltransf_29: Putative S-adenosyl-L-methionine- | 96.71 | |
| COG0286 | 489 | HsdM Type I restriction-modification system methyl | 96.7 | |
| PF07091 | 251 | FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: | 96.65 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 96.61 | |
| KOG1227|consensus | 351 | 96.56 | ||
| PF04989 | 206 | CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 | 96.55 | |
| COG3897 | 218 | Predicted methyltransferase [General function pred | 96.55 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 96.53 | |
| KOG3420|consensus | 185 | 96.52 | ||
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 96.52 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 96.49 | |
| KOG1596|consensus | 317 | 96.44 | ||
| PF07757 | 112 | AdoMet_MTase: Predicted AdoMet-dependent methyltra | 96.4 | |
| PF03492 | 334 | Methyltransf_7: SAM dependent carboxyl methyltrans | 96.34 | |
| PF10294 | 173 | Methyltransf_16: Putative methyltransferase; Inter | 96.32 | |
| KOG3115|consensus | 249 | 96.31 | ||
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 96.28 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 96.26 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 96.24 | |
| COG5459 | 484 | Predicted rRNA methylase [Translation, ribosomal s | 96.23 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 96.21 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 96.11 | |
| COG0275 | 314 | Predicted S-adenosylmethionine-dependent methyltra | 96.06 | |
| KOG1253|consensus | 525 | 96.04 | ||
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 95.99 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 95.97 | |
| PF11599 | 246 | AviRa: RRNA methyltransferase AviRa; InterPro: IPR | 95.97 | |
| PF01795 | 310 | Methyltransf_5: MraW methylase family; InterPro: I | 95.95 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 95.93 | |
| KOG1099|consensus | 294 | 95.89 | ||
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 95.85 | |
| PF06859 | 110 | Bin3: Bicoid-interacting protein 3 (Bin3); InterPr | 95.83 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 95.81 | |
| PLN02668 | 386 | indole-3-acetate carboxyl methyltransferase | 95.79 | |
| COG3129 | 292 | Predicted SAM-dependent methyltransferase [General | 95.77 | |
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 95.74 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 95.69 | |
| KOG2187|consensus | 534 | 95.69 | ||
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 95.68 | |
| COG1867 | 380 | TRM1 N2,N2-dimethylguanosine tRNA methyltransferas | 95.66 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 95.65 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 95.62 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 95.62 | |
| KOG1562|consensus | 337 | 95.59 | ||
| PRK04266 | 226 | fibrillarin; Provisional | 95.58 | |
| KOG2793|consensus | 248 | 95.53 | ||
| cd00315 | 275 | Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth | 95.53 | |
| PF13489 | 161 | Methyltransf_23: Methyltransferase domain; PDB: 3J | 95.52 | |
| KOG2920|consensus | 282 | 95.51 | ||
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 95.49 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 95.4 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 95.38 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 95.37 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 95.35 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 95.3 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 95.25 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 95.24 | |
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 95.24 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 95.21 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 95.2 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 95.2 | |
| PF05185 | 448 | PRMT5: PRMT5 arginine-N-methyltransferase; InterPr | 95.14 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 95.1 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 95.1 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 95.05 | |
| PF07021 | 193 | MetW: Methionine biosynthesis protein MetW; InterP | 94.98 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 94.95 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 94.86 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 94.84 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 94.83 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 94.77 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 94.77 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 94.72 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 94.72 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 94.69 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 94.68 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 94.68 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 94.66 | |
| PRK13699 | 227 | putative methylase; Provisional | 94.63 | |
| TIGR00027 | 260 | mthyl_TIGR00027 methyltransferase, putative, TIGR0 | 94.52 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 94.51 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 94.39 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 94.34 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 94.33 | |
| PRK09880 | 343 | L-idonate 5-dehydrogenase; Provisional | 94.32 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 94.29 | |
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 94.29 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 94.25 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 94.24 | |
| COG2813 | 300 | RsmC 16S RNA G1207 methylase RsmC [Translation, ri | 94.15 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 94.14 | |
| COG1064 | 339 | AdhP Zn-dependent alcohol dehydrogenases [General | 94.1 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 94.07 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 94.07 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 94.01 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 94.01 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 93.99 | |
| COG1568 | 354 | Predicted methyltransferases [General function pre | 93.97 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 93.93 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 93.93 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 93.91 | |
| COG4301 | 321 | Uncharacterized conserved protein [Function unknow | 93.9 | |
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 93.89 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 93.88 | |
| KOG1501|consensus | 636 | 93.84 | ||
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 93.66 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 93.64 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 93.57 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 93.55 | |
| COG1189 | 245 | Predicted rRNA methylase [Translation, ribosomal s | 93.53 | |
| PRK11524 | 284 | putative methyltransferase; Provisional | 93.5 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 93.49 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 93.44 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 93.44 | |
| KOG2904|consensus | 328 | 93.41 | ||
| PHA03412 | 241 | putative methyltransferase; Provisional | 93.4 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 93.4 | |
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 93.39 | |
| COG4076 | 252 | Predicted RNA methylase [General function predicti | 93.32 | |
| PHA01634 | 156 | hypothetical protein | 93.31 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 93.3 | |
| PF05711 | 248 | TylF: Macrocin-O-methyltransferase (TylF); InterPr | 93.17 | |
| COG0030 | 259 | KsgA Dimethyladenosine transferase (rRNA methylati | 93.16 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 93.15 | |
| PF01555 | 231 | N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th | 93.12 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 93.06 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 93.06 | |
| PF10354 | 166 | DUF2431: Domain of unknown function (DUF2431); Int | 93.03 | |
| PRK13699 | 227 | putative methylase; Provisional | 93.03 | |
| PF13679 | 141 | Methyltransf_32: Methyltransferase domain | 93.02 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 92.89 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 92.78 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 92.7 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 92.6 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 92.45 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 92.45 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 92.34 | |
| PF00145 | 335 | DNA_methylase: C-5 cytosine-specific DNA methylase | 92.3 | |
| cd08283 | 386 | FDH_like_1 Glutathione-dependent formaldehyde dehy | 92.17 | |
| KOG0024|consensus | 354 | 92.07 | ||
| PF08123 | 205 | DOT1: Histone methylation protein DOT1 ; InterPro: | 92.04 | |
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 92.02 | |
| smart00138 | 264 | MeTrc Methyltransferase, chemotaxis proteins. Meth | 92.0 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 91.93 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 91.79 | |
| COG1063 | 350 | Tdh Threonine dehydrogenase and related Zn-depende | 91.6 | |
| KOG2651|consensus | 476 | 91.6 | ||
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 91.59 | |
| COG4627 | 185 | Uncharacterized protein conserved in bacteria [Fun | 91.59 | |
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 91.49 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 91.43 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 91.42 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 91.38 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 91.2 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 91.16 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 91.06 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 91.01 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 90.9 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 90.88 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 90.87 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 90.83 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 90.75 | |
| TIGR00675 | 315 | dcm DNA-methyltransferase (dcm). All proteins in t | 90.75 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 90.5 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 90.37 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 90.34 | |
| PF02636 | 252 | Methyltransf_28: Putative S-adenosyl-L-methionine- | 90.3 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 90.3 | |
| COG2933 | 358 | Predicted SAM-dependent methyltransferase [General | 90.11 | |
| PRK01747 | 662 | mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans | 89.94 | |
| KOG1271|consensus | 227 | 89.9 | ||
| PF03269 | 177 | DUF268: Caenorhabditis protein of unknown function | 89.8 | |
| KOG2078|consensus | 495 | 89.8 | ||
| PRK11760 | 357 | putative 23S rRNA C2498 ribose 2'-O-ribose methylt | 89.68 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 89.58 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 89.36 | |
| PRK10458 | 467 | DNA cytosine methylase; Provisional | 89.23 | |
| PF10237 | 162 | N6-adenineMlase: Probable N6-adenine methyltransfe | 89.18 | |
| COG1565 | 370 | Uncharacterized conserved protein [Function unknow | 88.97 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 88.76 | |
| COG0116 | 381 | Predicted N6-adenine-specific DNA methylase [DNA r | 88.73 | |
| PRK09424 | 509 | pntA NAD(P) transhydrogenase subunit alpha; Provis | 88.71 | |
| KOG3924|consensus | 419 | 88.7 | ||
| KOG2915|consensus | 314 | 88.62 | ||
| PRK00811 | 283 | spermidine synthase; Provisional | 88.61 | |
| KOG2912|consensus | 419 | 88.57 | ||
| KOG1541|consensus | 270 | 88.49 | ||
| PF04072 | 183 | LCM: Leucine carboxyl methyltransferase; InterPro: | 88.46 | |
| PRK11677 | 134 | hypothetical protein; Provisional | 88.37 | |
| COG0686 | 371 | Ald Alanine dehydrogenase [Amino acid transport an | 88.2 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 88.13 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 88.03 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 87.91 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 87.68 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 87.67 | |
| cd08281 | 371 | liver_ADH_like1 Zinc-dependent alcohol dehydrogena | 87.54 | |
| cd08254 | 338 | hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo | 87.47 | |
| cd08230 | 355 | glucose_DH Glucose dehydrogenase. Glucose dehydrog | 87.37 | |
| TIGR03451 | 358 | mycoS_dep_FDH mycothiol-dependent formaldehyde deh | 87.36 | |
| KOG0821|consensus | 326 | 87.23 | ||
| cd08232 | 339 | idonate-5-DH L-idonate 5-dehydrogenase. L-idonate | 87.19 | |
| KOG0820|consensus | 315 | 87.04 | ||
| COG0270 | 328 | Dcm Site-specific DNA methylase [DNA replication, | 86.94 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 86.89 | |
| cd05188 | 271 | MDR Medium chain reductase/dehydrogenase (MDR)/zin | 86.84 | |
| PRK04338 | 382 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 86.34 | |
| PRK08324 | 681 | short chain dehydrogenase; Validated | 86.31 | |
| PF05206 | 259 | TRM13: Methyltransferase TRM13; InterPro: IPR00787 | 86.25 | |
| KOG2920|consensus | 282 | 85.81 | ||
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 85.8 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 85.42 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 85.16 | |
| COG4976 | 287 | Predicted methyltransferase (contains TPR repeat) | 84.92 | |
| cd08237 | 341 | ribitol-5-phosphate_DH ribitol-5-phosphate dehydro | 84.77 |
| >KOG1499|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=3e-31 Score=242.61 Aligned_cols=159 Identities=53% Similarity=0.878 Sum_probs=151.2
Q ss_pred CCcchhhhhhccchhhhhhhhchhHHHHHHHHHHHhcCCCCCCCeEEEecCCCChhhHHHHhcCCceEEeeecCCCcccH
Q psy8709 107 RRHDKYYFNSYEDAHIHAEMIKDTVRTESYKSAILNNNSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSGTPIRT 186 (319)
Q Consensus 107 ~~~~~~yf~~y~~~~~~~~m~~d~~r~~~~~~~i~~n~~~~~~~~vLD~G~GsG~l~i~aa~~ga~~V~avd~d~~~~~~ 186 (319)
...+++||.+|.++++|+.|++|.+|+.+|+.++..|..+|.+
T Consensus 19 ~~~~~~Yf~sY~~~~iheeML~D~VRt~aYr~~i~~n~~lf~d------------------------------------- 61 (346)
T KOG1499|consen 19 MTSDDYYFDSYAHFGIHEEMLKDSVRTLAYRNAILQNKHLFKD------------------------------------- 61 (346)
T ss_pred cchhhhhhhhhhchHHHHHHHhhhhhHHHHHHHHhcchhhcCC-------------------------------------
Confidence 3478999999999999999999999999999999999999999
Q ss_pred HHHHHHHhcccccCCCcceeeccCCCchHHHHHHHcCCCEEEEEecHHHHHHHHHHHHhcCCCCcEEEEEcCccccccCC
Q psy8709 187 ESYKSAILNNKSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSDIAYETIDIIRKNKYDSQIEVYHKLLEDVELPV 266 (319)
Q Consensus 187 ~~~~~~i~~~l~~~~~~~VLDiGcGtG~ls~~la~~g~~~V~gvD~s~~i~~a~~~~~~~g~~~~i~~i~~d~~~~~~~~ 266 (319)
+.|||+|||||.++++++++|+.+|+|+|.|.+++.|.+.+..|++.+.++++++.++++.+|.
T Consensus 62 ----------------K~VlDVGcGtGILS~F~akAGA~~V~aVe~S~ia~~a~~iv~~N~~~~ii~vi~gkvEdi~LP~ 125 (346)
T KOG1499|consen 62 ----------------KTVLDVGCGTGILSMFAAKAGARKVYAVEASSIADFARKIVKDNGLEDVITVIKGKVEDIELPV 125 (346)
T ss_pred ----------------CEEEEcCCCccHHHHHHHHhCcceEEEEechHHHHHHHHHHHhcCccceEEEeecceEEEecCc
Confidence 6788888888888888889889999999999988999999999999989999999999999998
Q ss_pred CceeEEEeccchhhhcchhhHHHHHHHHhcccCCCcEEEeecCcceeecccc
Q psy8709 267 ESVDIIISEWMGYFLLFETMIDSVIDARNRFLKPDGVVCPNRFTLSLCGAYA 318 (319)
Q Consensus 267 ~~fD~Iis~~~~~~l~~~~~~~~~l~~~~r~LkpgG~li~~~~t~~~~~~~~ 318 (319)
+++|+|+|+||+|++.+++++..+|.+..++|+|||.++|+.++++++|+++
T Consensus 126 eKVDiIvSEWMGy~Ll~EsMldsVl~ARdkwL~~~G~i~P~~a~l~l~~i~d 177 (346)
T KOG1499|consen 126 EKVDIIVSEWMGYFLLYESMLDSVLYARDKWLKEGGLIYPDRATLYLAAIED 177 (346)
T ss_pred cceeEEeehhhhHHHHHhhhhhhhhhhhhhccCCCceEccccceEEEEeccC
Confidence 9999999999999999999999999999999999999999999999999875
|
|
| >KOG1500|consensus | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1540|consensus | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >KOG1270|consensus | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >KOG1271|consensus | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4300|consensus | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >KOG2904|consensus | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >KOG1501|consensus | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2899|consensus | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species | Back alignment and domain information |
|---|
| >COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >KOG1975|consensus | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >KOG1541|consensus | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >KOG3010|consensus | Back alignment and domain information |
|---|
| >PRK13256 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >PLN02232 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >KOG2361|consensus | Back alignment and domain information |
|---|
| >KOG3191|consensus | Back alignment and domain information |
|---|
| >COG3963 Phospholipid N-methyltransferase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG0820|consensus | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3420|consensus | Back alignment and domain information |
|---|
| >KOG2940|consensus | Back alignment and domain information |
|---|
| >PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases | Back alignment and domain information |
|---|
| >PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1661|consensus | Back alignment and domain information |
|---|
| >PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >KOG3045|consensus | Back alignment and domain information |
|---|
| >PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 | Back alignment and domain information |
|---|
| >KOG1663|consensus | Back alignment and domain information |
|---|
| >TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase | Back alignment and domain information |
|---|
| >PRK10611 chemotaxis methyltransferase CheR; Provisional | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK00536 speE spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >KOG2915|consensus | Back alignment and domain information |
|---|
| >COG3897 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >KOG0822|consensus | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PF07942 N2227: N2227-like protein; InterPro: IPR012901 This family features sequences that are similar to a region of hypothetical yeast gene product N2227 (P53934 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >KOG2187|consensus | Back alignment and domain information |
|---|
| >PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes | Back alignment and domain information |
|---|
| >KOG2730|consensus | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] | Back alignment and domain information |
|---|
| >PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D | Back alignment and domain information |
|---|
| >KOG1331|consensus | Back alignment and domain information |
|---|
| >COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1122|consensus | Back alignment and domain information |
|---|
| >KOG1269|consensus | Back alignment and domain information |
|---|
| >KOG3178|consensus | Back alignment and domain information |
|---|
| >PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes | Back alignment and domain information |
|---|
| >KOG1709|consensus | Back alignment and domain information |
|---|
| >PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 | Back alignment and domain information |
|---|
| >PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein | Back alignment and domain information |
|---|
| >PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms | Back alignment and domain information |
|---|
| >COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PF04672 Methyltransf_19: S-adenosyl methyltransferase; InterPro: IPR006764 This is a family of uncharacterised proteins | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00357 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4058|consensus | Back alignment and domain information |
|---|
| >COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG3201|consensus | Back alignment and domain information |
|---|
| >KOG4589|consensus | Back alignment and domain information |
|---|
| >PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases | Back alignment and domain information |
|---|
| >KOG2352|consensus | Back alignment and domain information |
|---|
| >PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR00006 S-adenosyl-methyltransferase MraW | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >KOG1499|consensus | Back alignment and domain information |
|---|
| >KOG2899|consensus | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >KOG2671|consensus | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 | Back alignment and domain information |
|---|
| >KOG2798|consensus | Back alignment and domain information |
|---|
| >COG4798 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1500|consensus | Back alignment and domain information |
|---|
| >KOG2198|consensus | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised | Back alignment and domain information |
|---|
| >PHA01634 hypothetical protein | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1270|consensus | Back alignment and domain information |
|---|
| >PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >KOG3987|consensus | Back alignment and domain information |
|---|
| >PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases | Back alignment and domain information |
|---|
| >COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF07091 FmrO: Ribosomal RNA methyltransferase (FmrO); PDB: 3LCU_A 3LCV_B 3FRH_A 3FRI_A 3B89_A 3FZG_A | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1227|consensus | Back alignment and domain information |
|---|
| >PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] | Back alignment and domain information |
|---|
| >COG3897 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >KOG3420|consensus | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >KOG1596|consensus | Back alignment and domain information |
|---|
| >PF07757 AdoMet_MTase: Predicted AdoMet-dependent methyltransferase; InterPro: IPR011671 tRNA (uracil-O(2)-)-methyltransferase catalyses the formation of O(2)-methyl-uracil at position 44 (m2U44) in tRNA(Ser) [] | Back alignment and domain information |
|---|
| >PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine | Back alignment and domain information |
|---|
| >PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases | Back alignment and domain information |
|---|
| >KOG3115|consensus | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >COG5459 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >KOG1253|consensus | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes | Back alignment and domain information |
|---|
| >PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >KOG1099|consensus | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02668 indole-3-acetate carboxyl methyltransferase | Back alignment and domain information |
|---|
| >COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2187|consensus | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1562|consensus | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >KOG2793|consensus | Back alignment and domain information |
|---|
| >cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology | Back alignment and domain information |
|---|
| >PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C | Back alignment and domain information |
|---|
| >KOG2920|consensus | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00027 mthyl_TIGR00027 methyltransferase, putative, TIGR00027 family | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PRK09880 L-idonate 5-dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG1568 Predicted methyltransferases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >COG4301 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1501|consensus | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11524 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2904|consensus | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >COG4076 Predicted RNA methylase [General function prediction only] | Back alignment and domain information |
|---|
| >PHA01634 hypothetical protein | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >PF05711 TylF: Macrocin-O-methyltransferase (TylF); InterPro: IPR008884 This family consists of bacterial macrocin O-methyltransferase (TylF) proteins | Back alignment and domain information |
|---|
| >COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known | Back alignment and domain information |
|---|
| >PRK13699 putative methylase; Provisional | Back alignment and domain information |
|---|
| >PF13679 Methyltransf_32: Methyltransferase domain | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 | Back alignment and domain information |
|---|
| >cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 | Back alignment and domain information |
|---|
| >KOG0024|consensus | Back alignment and domain information |
|---|
| >PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >smart00138 MeTrc Methyltransferase, chemotaxis proteins | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >KOG2651|consensus | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >COG4627 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00675 dcm DNA-methyltransferase (dcm) | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >PF02636 Methyltransf_28: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR003788 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG2933 Predicted SAM-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed | Back alignment and domain information |
|---|
| >KOG1271|consensus | Back alignment and domain information |
|---|
| >PF03269 DUF268: Caenorhabditis protein of unknown function, DUF268; InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species | Back alignment and domain information |
|---|
| >KOG2078|consensus | Back alignment and domain information |
|---|
| >PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK10458 DNA cytosine methylase; Provisional | Back alignment and domain information |
|---|
| >PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre | Back alignment and domain information |
|---|
| >COG1565 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >KOG3924|consensus | Back alignment and domain information |
|---|
| >KOG2915|consensus | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >KOG2912|consensus | Back alignment and domain information |
|---|
| >KOG1541|consensus | Back alignment and domain information |
|---|
| >PF04072 LCM: Leucine carboxyl methyltransferase; InterPro: IPR007213 This entry represents a group of leucine carboxymethyltransferases which methylate the carboxyl group of leucine residues to form alpha-leucine ester residues | Back alignment and domain information |
|---|
| >PRK11677 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) | Back alignment and domain information |
|---|
| >cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members | Back alignment and domain information |
|---|
| >cd08230 glucose_DH Glucose dehydrogenase | Back alignment and domain information |
|---|
| >TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase | Back alignment and domain information |
|---|
| >KOG0821|consensus | Back alignment and domain information |
|---|
| >cd08232 idonate-5-DH L-idonate 5-dehydrogenase | Back alignment and domain information |
|---|
| >KOG0820|consensus | Back alignment and domain information |
|---|
| >COG0270 Dcm Site-specific DNA methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family | Back alignment and domain information |
|---|
| >PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK08324 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF05206 TRM13: Methyltransferase TRM13; InterPro: IPR007871 This entry consists of eukaryotic and bacterial proteins that specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signatures [] | Back alignment and domain information |
|---|
| >KOG2920|consensus | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] | Back alignment and domain information |
|---|
| >cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 319 | ||||
| 2fyt_A | 340 | Human Hmt1 Hnrnp Methyltransferase-Like 3 (S. Cerev | 1e-31 | ||
| 1f3l_A | 321 | Crystal Structure Of The Conserved Core Of Protein | 1e-30 | ||
| 3q7e_A | 349 | Crystal Structure Of Rat Protein Arginine Methyltra | 6e-29 | ||
| 1ori_A | 343 | Structure Of The Predominant Protein Arginine Methy | 7e-29 | ||
| 1or8_A | 340 | Structure Of The Predominant Protein Arginine Methy | 7e-29 | ||
| 1orh_A | 353 | Structure Of The Predominant Protein Arginine Methy | 1e-28 | ||
| 1g6q_1 | 328 | Crystal Structure Of Yeast Arginine Methyltransfera | 3e-28 | ||
| 3r0q_C | 376 | A Uniquely Open Conformation Revealed In The Crysta | 1e-25 | ||
| 4hc4_A | 376 | Human Hmt1 Hnrnp Methyltransferase-Like Protein 6 ( | 6e-24 | ||
| 3b3j_A | 480 | The 2.55 A Crystal Structure Of The Apo Catalytic D | 8e-18 | ||
| 2y1w_A | 348 | Crystal Structure Of Coactivator Associated Arginin | 1e-17 | ||
| 4ikp_A | 341 | Crystal Structure Of Coactivator-associated Arginin | 1e-17 | ||
| 2v74_B | 346 | Crystal Structure Of Coactivator-Associated Arginin | 1e-17 | ||
| 3b3f_A | 341 | The 2.2 A Crystal Structure Of The Catalytic Domain | 1e-17 |
| >pdb|2FYT|A Chain A, Human Hmt1 Hnrnp Methyltransferase-Like 3 (S. Cerevisiae) Protein Length = 340 | Back alignment and structure |
|
| >pdb|1F3L|A Chain A, Crystal Structure Of The Conserved Core Of Protein Arginine Methyltransferase Prmt3 Length = 321 | Back alignment and structure |
| >pdb|3Q7E|A Chain A, Crystal Structure Of Rat Protein Arginine Methyltransferase 1 (Prmt1) M48l Mutant Length = 349 | Back alignment and structure |
| >pdb|1ORI|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 343 | Back alignment and structure |
| >pdb|1OR8|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 340 | Back alignment and structure |
| >pdb|1ORH|A Chain A, Structure Of The Predominant Protein Arginine Methyltransferase Prmt1 Length = 353 | Back alignment and structure |
| >pdb|1G6Q|1 Chain 1, Crystal Structure Of Yeast Arginine Methyltransferase, Hmt1 Length = 328 | Back alignment and structure |
| >pdb|3R0Q|C Chain C, A Uniquely Open Conformation Revealed In The Crystal Structure Of Arabidopsis Thaliana Protein Arginine Methyltransferase 10 Length = 376 | Back alignment and structure |
| >pdb|4HC4|A Chain A, Human Hmt1 Hnrnp Methyltransferase-Like Protein 6 (S. Cerevisiae) Length = 376 | Back alignment and structure |
| >pdb|3B3J|A Chain A, The 2.55 A Crystal Structure Of The Apo Catalytic Domain Of Coactivator-Associated Arginine Methyl Transferase I(Carm1:28-507, Residues 28-146 And 479-507 Not Ordered) Length = 480 | Back alignment and structure |
| >pdb|2Y1W|A Chain A, Crystal Structure Of Coactivator Associated Arginine Methyltransferase 1 (Carm1) In Complex With Sinefungin And Indole Inhibitor Length = 348 | Back alignment and structure |
| >pdb|4IKP|A Chain A, Crystal Structure Of Coactivator-associated Arginine Methyltransferase 1 Length = 341 | Back alignment and structure |
| >pdb|2V74|B Chain B, Crystal Structure Of Coactivator-Associated Arginine Methyltransferase 1 (Carm1), In Complex With S-Adenosyl- Homocysteine Length = 346 | Back alignment and structure |
| >pdb|3B3F|A Chain A, The 2.2 A Crystal Structure Of The Catalytic Domain Of Coactivator- Associated Arginine Methyl Transferase I(Carm1,142-478), In Complex With S-Adenosyl Homocysteine Length = 341 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 319 | |||
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 3e-53 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 5e-52 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 4e-49 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 6e-47 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 2e-46 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 3e-44 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 2e-31 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 1e-17 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 9e-16 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 5e-13 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 2e-12 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 2e-11 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 4e-11 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 1e-10 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 2e-10 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 2e-04 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 3e-10 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 3e-04 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 1e-09 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 4e-09 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 4e-05 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 4e-09 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 9e-07 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 2e-08 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 3e-08 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 4e-08 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 1e-07 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 2e-04 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 2e-07 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 2e-07 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 2e-07 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 2e-07 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 3e-05 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 3e-07 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 2e-05 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 3e-07 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 4e-07 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 5e-07 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 6e-07 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 8e-07 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 8e-07 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 9e-07 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 1e-06 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 1e-06 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 1e-06 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 1e-06 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 2e-06 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 2e-06 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 5e-06 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 2e-06 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 3e-06 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 8e-05 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 3e-06 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 3e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-06 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 6e-06 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 7e-06 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 9e-06 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 1e-05 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 1e-05 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 1e-05 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 1e-05 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 2e-05 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 2e-05 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 2e-05 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 3e-05 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 4e-04 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 4e-05 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 4e-05 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 5e-05 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 5e-05 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 6e-05 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 6e-05 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 7e-05 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 1e-04 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 1e-04 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 1e-04 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 2e-04 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 2e-04 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 3e-04 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 3e-04 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 4e-04 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 4e-04 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 4e-04 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 5e-04 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 6e-04 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 6e-04 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 6e-04 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 6e-04 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 7e-04 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 7e-04 |
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Length = 340 | Back alignment and structure |
|---|
Score = 177 bits (449), Expect = 3e-53
Identities = 83/220 (37%), Positives = 112/220 (50%), Gaps = 53/220 (24%)
Query: 97 EEDEEGENKTRRHDKYYFNSYEDAHIHAEMIKDTVRTESYKSAILNNNSLFNNKHVIDVG 156
G + D YF+SY IH EM+KD +RTESY+ I N
Sbjct: 13 GLVPRGSDLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQN------------- 59
Query: 157 AGTGILSIFAAQAGAAKVFAIEKSGTPIRTESYKSAILNNKSLFNNKHVIDVGAGTGILS 216
+F +K V+DVG GTGILS
Sbjct: 60 ----------------------------------------PHIFKDKVVLDVGCGTGILS 79
Query: 217 IFAAQAGAAKVFAIEKSDIAYETIDIIRKNKYDSQIEVYHKLLEDVELPVESVDIIISEW 276
+FAA+AGA KV +++S+I Y+ +DIIR NK + I + +E+V LPVE VD+IISEW
Sbjct: 80 MFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEW 139
Query: 277 MGYFLLFETMIDSVIDARNRFLKPDGVVCPNRFTLSLCGA 316
MGYFLLFE+M+DSV+ A+N++L G V P+ T+SL
Sbjct: 140 MGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAV 179
|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Length = 349 | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Length = 328 | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Length = 348 | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Length = 480 | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Length = 376 | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Length = 745 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Length = 267 | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Length = 253 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Length = 257 | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Length = 225 | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Length = 244 | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Length = 230 | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Length = 243 | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Length = 170 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Length = 250 | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Length = 230 | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Length = 192 | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Length = 205 | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Length = 205 | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Length = 216 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Length = 227 | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Length = 217 | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Length = 207 | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Length = 207 | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Length = 259 | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Length = 199 | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Length = 200 | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Length = 200 | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Length = 183 | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Length = 234 | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Length = 219 | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Length = 293 | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 203 | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Length = 209 | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Length = 202 | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Length = 187 | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Length = 220 | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Length = 177 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Length = 219 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for structural genomics; 1.70A {Bacillus thuringiensis} Length = 242 | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Length = 240 | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Length = 254 | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Length = 254 | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Length = 254 | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Length = 245 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Length = 211 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Length = 195 | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Length = 204 | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Length = 218 | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Length = 950 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Length = 286 | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 227 | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Length = 260 | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Length = 260 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Length = 281 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Length = 281 | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Length = 201 | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Length = 299 | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Length = 202 | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Length = 256 | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Length = 235 | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} Length = 204 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Length = 266 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Length = 241 | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Length = 261 | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Length = 189 | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Length = 194 | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Length = 239 | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Length = 246 | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Length = 252 | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Length = 263 | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} SCOP: c.66.1.47 PDB: 3k6r_A 3a25_A* 3a26_A* Length = 278 | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Length = 230 | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Length = 353 | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Length = 298 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 319 | |||
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 99.97 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 99.9 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 99.9 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 99.9 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 99.89 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 99.86 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 99.79 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 99.78 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 99.74 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 99.72 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 99.71 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 99.71 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 99.7 | |
| 3ua3_A | 745 | Protein arginine N-methyltransferase 5; TIM-barrel | 99.7 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 99.7 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 99.69 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 99.69 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 99.69 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 99.69 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 99.68 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 99.68 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 99.68 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 99.67 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 99.67 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 99.66 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 99.66 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 99.66 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 99.66 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 99.65 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 99.65 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 99.65 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 99.64 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 99.64 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 99.64 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 99.64 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 99.64 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 99.64 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 99.64 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 99.64 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 99.63 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 99.63 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 99.63 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 99.63 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 99.63 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 99.62 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 99.62 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 99.62 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 99.62 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 99.62 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 99.62 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 99.62 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 99.61 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 99.61 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 99.61 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 99.61 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 99.61 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 99.61 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 99.6 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 99.6 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 99.6 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 99.6 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 99.6 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 99.6 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 99.59 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 99.59 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 99.59 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 99.59 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 99.59 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 99.58 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 99.58 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 99.58 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 99.58 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 99.58 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 99.58 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 99.58 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 99.57 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 99.57 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 99.57 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 99.57 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 99.57 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 99.57 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 99.57 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 99.57 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 99.56 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 99.56 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 99.56 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 99.56 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 99.56 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 99.56 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 99.56 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 99.55 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 99.55 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 99.55 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 99.55 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 99.55 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 99.55 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 99.55 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 99.54 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 99.54 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 99.54 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 99.54 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 99.54 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 99.54 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 99.54 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 99.53 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 99.53 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 99.53 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 99.53 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 99.53 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 99.53 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 99.53 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 99.52 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 99.52 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 99.52 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 99.52 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 99.52 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 99.52 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 99.51 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 99.51 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 99.51 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 99.51 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 99.5 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 99.5 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 99.5 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 99.5 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 99.5 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 99.49 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 99.49 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 99.49 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 99.49 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 99.49 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 99.49 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 99.49 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 99.49 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 99.49 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 99.49 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 99.48 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 99.48 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 99.48 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 99.48 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 99.48 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 99.48 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 99.48 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 99.47 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 99.47 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 99.47 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 99.47 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 99.46 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 99.46 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 99.46 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 99.46 | |
| 2aot_A | 292 | HMT, histamine N-methyltransferase; classic methyl | 99.46 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 99.46 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 99.45 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 99.45 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 99.45 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 99.45 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 99.45 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 99.45 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 99.45 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 99.45 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 99.44 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 99.44 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 99.44 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 99.44 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 99.44 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 99.43 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 99.43 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 99.43 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 99.43 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 99.43 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 99.43 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 99.43 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 99.43 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 99.42 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 99.42 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 99.42 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 99.42 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 99.42 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 99.41 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 99.41 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 99.41 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 99.41 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 99.4 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 99.4 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 99.4 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 99.4 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 99.4 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 99.39 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 99.39 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 99.39 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 99.39 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 99.39 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 99.39 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 99.39 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 99.39 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 99.38 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 99.38 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 99.38 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 99.38 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 99.37 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 99.37 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 99.36 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 99.36 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 99.35 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 99.35 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 99.35 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 99.35 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 99.34 | |
| 1af7_A | 274 | Chemotaxis receptor methyltransferase CHER; chemot | 99.34 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 99.34 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 99.34 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 99.33 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 99.33 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 99.33 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 99.32 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 99.31 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 99.31 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 99.31 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 99.3 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 99.3 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 99.3 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 99.29 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 99.29 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 99.28 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 99.28 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 99.28 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 99.28 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 99.28 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 99.28 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 99.26 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 99.26 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 99.25 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 99.25 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 99.24 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 99.24 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 99.23 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 99.23 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 99.22 | |
| 2zfu_A | 215 | Nucleomethylin, cerebral protein 1; nucleolar prot | 99.2 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 99.2 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 99.2 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 99.18 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 99.18 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 99.18 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 99.18 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 99.17 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 99.17 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 99.16 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 99.16 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 99.15 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 99.15 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 99.15 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 99.15 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 99.15 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 99.14 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 99.11 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 99.1 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 99.1 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 99.08 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 99.08 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 99.07 | |
| 2ld4_A | 176 | Anamorsin; methyltransferase-like fold, alpha/beta | 99.07 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 98.99 | |
| 1zg3_A | 358 | Isoflavanone 4'-O-methyltransferase; rossman fold, | 98.96 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 98.92 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 98.91 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 98.87 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 98.86 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 98.85 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 98.85 | |
| 3cvo_A | 202 | Methyltransferase-like protein of unknown functio; | 98.82 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 98.8 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 98.77 | |
| 3khk_A | 544 | Type I restriction-modification system methylation | 98.76 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 98.76 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 98.7 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 98.69 | |
| 3o4f_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 98.59 | |
| 3evf_A | 277 | RNA-directed RNA polymerase NS5; NS5 methyltransfe | 98.58 | |
| 3s1s_A | 878 | Restriction endonuclease bpusi; PD--(D/E)XK cataly | 98.54 | |
| 2wk1_A | 282 | NOVP; transferase, O-methyltransferase, novobiocin | 98.43 | |
| 3b5i_A | 374 | S-adenosyl-L-methionine:salicylic acid carboxyl me | 98.41 | |
| 3gcz_A | 282 | Polyprotein; flavivirus, RNA capping, methyltransf | 98.32 | |
| 3c6k_A | 381 | Spermine synthase; spermidine aminopropyltransfera | 98.3 | |
| 4auk_A | 375 | Ribosomal RNA large subunit methyltransferase M; Y | 98.26 | |
| 2qy6_A | 257 | UPF0209 protein YFCK; structural genomics, unknown | 98.23 | |
| 2efj_A | 384 | 3,7-dimethylxanthine methyltransferase; SAM-depend | 98.22 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 98.19 | |
| 3ufb_A | 530 | Type I restriction-modification system methyltran | 98.19 | |
| 3p8z_A | 267 | Mtase, non-structural protein 5; methyltransferase | 98.1 | |
| 1m6e_X | 359 | S-adenosyl-L-methionnine:salicylic acid carboxyl m | 98.03 | |
| 2px2_A | 269 | Genome polyprotein [contains: capsid protein C (co | 97.98 | |
| 3eld_A | 300 | Methyltransferase; flavivirus, RNA capping, guanyl | 97.97 | |
| 3lkz_A | 321 | Non-structural protein 5; flavivirus, methyltransf | 97.93 | |
| 2k4m_A | 153 | TR8_protein, UPF0146 protein MTH_1000; alpha+beta, | 97.87 | |
| 2oo3_A | 283 | Protein involved in catabolism of external DNA; st | 97.77 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 97.65 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 97.59 | |
| 3r24_A | 344 | NSP16, 2'-O-methyl transferase; methyltransferase, | 97.21 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 97.2 | |
| 3tka_A | 347 | Ribosomal RNA small subunit methyltransferase H; H | 97.15 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 97.14 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 97.11 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 97.09 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 97.08 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 97.07 | |
| 1g60_A | 260 | Adenine-specific methyltransferase MBOIIA; structu | 97.07 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 97.04 | |
| 1i4w_A | 353 | Mitochondrial replication protein MTF1; mitochondr | 97.04 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 97.03 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 96.96 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 96.96 | |
| 2a14_A | 263 | Indolethylamine N-methyltransferase; SGC,INMT, str | 96.9 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 96.9 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 96.79 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 96.78 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 96.76 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 96.72 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 96.69 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 96.65 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 96.63 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 96.53 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 96.53 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 96.53 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 96.52 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 96.51 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 96.5 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 96.5 | |
| 1rjd_A | 334 | PPM1P, carboxy methyl transferase for protein phos | 96.5 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 96.49 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 96.48 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 96.47 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 96.45 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 96.41 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 96.41 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 96.39 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 96.38 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 96.36 | |
| 3g7u_A | 376 | Cytosine-specific methyltransferase; DNA-binding, | 96.36 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 96.34 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 96.33 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 96.32 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 96.3 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 96.3 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 96.27 | |
| 2uyo_A | 310 | Hypothetical protein ML2640; putative methyltransf | 96.27 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 96.26 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 96.25 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 96.24 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 96.23 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 96.23 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 96.22 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 96.21 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 96.2 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 96.18 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 96.17 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 96.15 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 96.14 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 96.13 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 96.13 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 96.13 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 96.11 | |
| 4azs_A | 569 | Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 | 96.1 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 96.1 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 96.09 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 96.08 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 96.08 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 96.08 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 96.04 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 96.04 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 96.02 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 96.02 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 96.01 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 96.0 | |
| 1g55_A | 343 | DNA cytosine methyltransferase DNMT2; human DNA me | 96.0 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 95.99 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 95.97 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 95.97 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 95.95 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 95.95 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 95.95 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 95.94 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 95.94 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 95.93 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 95.93 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 95.92 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 95.89 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 95.88 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 95.87 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 95.87 | |
| 3frh_A | 253 | 16S rRNA methylase; methyltransferase domain, heli | 95.86 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 95.86 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 95.85 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 95.83 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 95.82 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 95.81 | |
| 2c7p_A | 327 | Modification methylase HHAI; DNA methyltransferase | 95.8 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 95.8 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 95.79 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 95.73 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 95.72 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 95.71 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 95.7 | |
| 2py6_A | 409 | Methyltransferase FKBM; YP_546752.1, structural ge | 95.68 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 95.65 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 95.65 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 95.65 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 95.65 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 95.62 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 95.61 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 95.59 | |
| 1f8f_A | 371 | Benzyl alcohol dehydrogenase; rossmann fold, oxido | 95.58 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 95.57 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 95.56 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 95.52 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 95.52 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 95.52 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 95.52 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 95.5 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 95.49 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 95.47 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 95.46 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 95.46 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 95.46 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 95.46 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 95.45 | |
| 3tos_A | 257 | CALS11; methyltransferase, calicheamicin, structur | 95.44 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 95.44 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 95.44 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 95.43 | |
| 4gqb_A | 637 | Protein arginine N-methyltransferase 5; TIM barrel | 95.42 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 95.42 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 95.41 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 95.41 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 95.4 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 95.4 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 95.4 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 95.4 | |
| 2g72_A | 289 | Phenylethanolamine N-methyltransferase; HET: SAM F | 95.4 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 95.39 | |
| 2vz8_A | 2512 | Fatty acid synthase; transferase, phosphopantethei | 95.37 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 95.36 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 95.36 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 95.34 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 95.33 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 95.33 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 95.33 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 95.32 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 95.31 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 95.29 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 95.27 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 95.23 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 95.23 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 95.23 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 95.22 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 95.18 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 95.18 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 95.18 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 95.17 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 95.12 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 95.11 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 95.11 | |
| 3vyw_A | 308 | MNMC2; tRNA wobble uridine, modification enzyme, g | 95.09 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 95.08 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 95.07 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 95.06 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 95.06 | |
| 3ubt_Y | 331 | Modification methylase HAEIII; protein-DNA complex | 95.02 | |
| 3lcv_B | 281 | Sisomicin-gentamicin resistance methylase SGM; ant | 95.01 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 94.99 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 94.99 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 94.96 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 94.94 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 94.94 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 94.93 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 94.91 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 94.89 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 94.89 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 94.84 | |
| 3qv2_A | 327 | 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H | 94.84 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 94.81 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 94.79 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 94.79 | |
| 1boo_A | 323 | Protein (N-4 cytosine-specific methyltransferase P | 94.77 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 94.76 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 94.75 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 94.75 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 94.69 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 94.68 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 94.62 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 94.59 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 94.56 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 94.55 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 94.51 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 94.5 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 94.48 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 94.47 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 94.47 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 94.45 |
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.97 E-value=1.1e-31 Score=253.93 Aligned_cols=159 Identities=45% Similarity=0.748 Sum_probs=141.1
Q ss_pred CCCcchhhhhhccchhhhhhhhchhHHHHHHHHHHHhcCCCCCCCeEEEecCCCChhhHHHHhcCCceEEeeecCCCccc
Q psy8709 106 TRRHDKYYFNSYEDAHIHAEMIKDTVRTESYKSAILNNNSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSGTPIR 185 (319)
Q Consensus 106 ~~~~~~~yf~~y~~~~~~~~m~~d~~r~~~~~~~i~~n~~~~~~~~vLD~G~GsG~l~i~aa~~ga~~V~avd~d~~~~~ 185 (319)
.++.|++||++|+++++|+.|++|.+|+..|.++|..|...++|
T Consensus 41 ~~~~d~~Yf~sY~~~~iH~~ML~D~~Rt~aY~~Ai~~~~~~~~~------------------------------------ 84 (376)
T 4hc4_A 41 KRERDQLYYECYSDVSVHEEMIADRVRTDAYRLGILRNWAALRG------------------------------------ 84 (376)
T ss_dssp --------CCCHHHHHHHHHHHHCHHHHHHHHHHHHTTHHHHTT------------------------------------
T ss_pred cccchhhhhhhccCcHHHHHHhCCHHHHHHHHHHHHhCHHhcCC------------------------------------
Confidence 45788999999999999999999999999999999888777777
Q ss_pred HHHHHHHHhcccccCCCcceeeccCCCchHHHHHHHcCCCEEEEEecHHHHHHHHHHHHhcCCCCcEEEEEcCccccccC
Q psy8709 186 TESYKSAILNNKSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSDIAYETIDIIRKNKYDSQIEVYHKLLEDVELP 265 (319)
Q Consensus 186 ~~~~~~~i~~~l~~~~~~~VLDiGcGtG~ls~~la~~g~~~V~gvD~s~~i~~a~~~~~~~g~~~~i~~i~~d~~~~~~~ 265 (319)
++|||||||+|.+++++++.|+++|+|||.|++++.|+++++.|++.++|++++++++++.+|
T Consensus 85 -----------------k~VLDvG~GtGiLs~~Aa~aGA~~V~ave~s~~~~~a~~~~~~n~~~~~i~~i~~~~~~~~lp 147 (376)
T 4hc4_A 85 -----------------KTVLDVGAGTGILSIFCAQAGARRVYAVEASAIWQQAREVVRFNGLEDRVHVLPGPVETVELP 147 (376)
T ss_dssp -----------------CEEEEETCTTSHHHHHHHHTTCSEEEEEECSTTHHHHHHHHHHTTCTTTEEEEESCTTTCCCS
T ss_pred -----------------CEEEEeCCCccHHHHHHHHhCCCEEEEEeChHHHHHHHHHHHHcCCCceEEEEeeeeeeecCC
Confidence 678888888888888888888889999999998899999999999999999999999999888
Q ss_pred CCceeEEEeccchhhhcchhhHHHHHHHHhcccCCCcEEEeecCcceeecccc
Q psy8709 266 VESVDIIISEWMGYFLLFETMIDSVIDARNRFLKPDGVVCPNRFTLSLCGAYA 318 (319)
Q Consensus 266 ~~~fD~Iis~~~~~~l~~~~~~~~~l~~~~r~LkpgG~li~~~~t~~~~~~~~ 318 (319)
++||+|+|+++++++.++.++..++.+..++|||||.++|+.+++|++|+..
T Consensus 148 -e~~DvivsE~~~~~l~~e~~l~~~l~a~~r~Lkp~G~~iP~~atly~apie~ 199 (376)
T 4hc4_A 148 -EQVDAIVSEWMGYGLLHESMLSSVLHARTKWLKEGGLLLPASAELFIVPISD 199 (376)
T ss_dssp -SCEEEEECCCCBTTBTTTCSHHHHHHHHHHHEEEEEEEESCEEEEEEEEECC
T ss_pred -ccccEEEeecccccccccchhhhHHHHHHhhCCCCceECCccceEEEEEecc
Confidence 7899999999999999999999999999999999999999999999999874
|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* | Back alignment and structure |
|---|
| >3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} | Back alignment and structure |
|---|
| >2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} | Back alignment and structure |
|---|
| >3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} | Back alignment and structure |
|---|
| >3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* | Back alignment and structure |
|---|
| >4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* | Back alignment and structure |
|---|
| >2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* | Back alignment and structure |
|---|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* | Back alignment and structure |
|---|
| >1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 | Back alignment and structure |
|---|
| >2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* | Back alignment and structure |
|---|
| >3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* | Back alignment and structure |
|---|
| >3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} | Back alignment and structure |
|---|
| >2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} | Back alignment and structure |
|---|
| >2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1rjd_A PPM1P, carboxy methyl transferase for protein phosphatase 2A catalytic subunit; SAM dependent methyltransferase; HET: SAM; 1.80A {Saccharomyces cerevisiae} SCOP: c.66.1.37 PDB: 1rje_A* 1rjf_A 1rjg_A* 2ob2_A* 2ob1_A | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >2uyo_A Hypothetical protein ML2640; putative methyltransferase, transferas; 1.7A {Mycobacterium leprae} SCOP: c.66.1.57 PDB: 2ckd_A 2uyq_A* | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* | Back alignment and structure |
|---|
| >3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 319 | ||||
| d1oria_ | 316 | c.66.1.6 (A:) Protein arginine N-methyltransferase | 3e-30 | |
| d2fyta1 | 311 | c.66.1.6 (A:238-548) Protein arginine N-methyltran | 2e-29 | |
| d1g6q1_ | 328 | c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Ba | 6e-29 | |
| d1ri5a_ | 252 | c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf | 2e-07 | |
| d1ri5a_ | 252 | c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransf | 0.001 | |
| d1xvaa_ | 292 | c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra | 2e-07 | |
| d1xvaa_ | 292 | c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Ra | 1e-04 | |
| d2frna1 | 260 | c.66.1.47 (A:19-278) Hypothetical protein PH0793 { | 9e-07 | |
| d1nkva_ | 245 | c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric | 1e-06 | |
| d1nkva_ | 245 | c.66.1.21 (A:) Hypothetical Protein YjhP {Escheric | 2e-04 | |
| d1xxla_ | 234 | c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus | 2e-06 | |
| d1vl5a_ | 231 | c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill | 3e-06 | |
| d1vl5a_ | 231 | c.66.1.41 (A:) Hypothetical protein BH2331 {Bacill | 5e-04 | |
| d2gh1a1 | 281 | c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bac | 2e-05 | |
| d2p7ia1 | 225 | c.66.1.41 (A:22-246) Hypothetical protein ECA1738 | 2e-05 | |
| d2esra1 | 152 | c.66.1.46 (A:28-179) Putative methyltransferase SP | 6e-05 | |
| d1i4wa_ | 322 | c.66.1.24 (A:) Transcription factor sc-mtTFB {Bake | 2e-04 | |
| d2dula1 | 375 | c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tR | 2e-04 | |
| d1l3ia_ | 186 | c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi | 3e-04 | |
| d1wzna1 | 251 | c.66.1.43 (A:1-251) Hypothetical methyltransferase | 7e-04 | |
| d2py6a1 | 395 | c.66.1.56 (A:14-408) Methyltransferase FkbM {Methy | 8e-04 | |
| d1i9ga_ | 264 | c.66.1.13 (A:) Probable methyltransferase Rv2118c | 9e-04 | |
| d1y8ca_ | 246 | c.66.1.43 (A:) Putative methyltransferase CAC2371 | 0.001 | |
| d1y8ca_ | 246 | c.66.1.43 (A:) Putative methyltransferase CAC2371 | 0.001 | |
| d1ne2a_ | 197 | c.66.1.32 (A:) Hypothetical protein Ta1320 {Archae | 0.001 | |
| d1yb2a1 | 250 | c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T | 0.001 | |
| d2i6ga1 | 198 | c.66.1.44 (A:1-198) Putative methyltransferase Teh | 0.002 | |
| d1nw3a_ | 328 | c.66.1.31 (A:) Catalytic, N-terminal domain of his | 0.004 | |
| d1u2za_ | 406 | c.66.1.31 (A:) Catalytic, N-terminal domain of his | 0.004 |
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 316 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Arginine methyltransferase domain: Protein arginine N-methyltransferase 1, PRMT1 species: Rat (Rattus norvegicus) [TaxId: 10116]
Score = 114 bits (286), Expect = 3e-30
Identities = 64/133 (48%), Positives = 98/133 (73%)
Query: 183 PIRTESYKSAILNNKSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSDIAYETIDI 242
+RT +Y++++ +N+ LF +K V+DVG+GTGIL +FAA+AGA KV IE S I+ + I
Sbjct: 15 EVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKI 74
Query: 243 IRKNKYDSQIEVYHKLLEDVELPVESVDIIISEWMGYFLLFETMIDSVIDARNRFLKPDG 302
++ NK D + + +E+VELPVE VDIIISEWMGY L +E+M+++V+ AR+++L PDG
Sbjct: 75 VKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLHARDKWLAPDG 134
Query: 303 VVCPNRFTLSLCG 315
++ P+R TL +
Sbjct: 135 LIFPDRATLYVTA 147
|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 311 | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 328 | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Length = 252 | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 292 | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Length = 260 | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Length = 245 | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Length = 234 | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Length = 231 | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Length = 281 | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Length = 225 | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Length = 152 | Back information, alignment and structure |
|---|
| >d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 322 | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Length = 375 | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 251 | Back information, alignment and structure |
|---|
| >d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Length = 395 | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Length = 264 | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Length = 246 | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 197 | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Length = 198 | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Length = 328 | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 406 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 319 | |||
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 99.94 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 99.93 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 99.93 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 99.81 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 99.8 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 99.8 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 99.79 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 99.78 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 99.76 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 99.74 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 99.74 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 99.74 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 99.72 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 99.7 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 99.7 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 99.69 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 99.68 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 99.68 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.67 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 99.67 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 99.67 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 99.66 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 99.64 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 99.63 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 99.62 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 99.61 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 99.6 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 99.6 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 99.6 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 99.59 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 99.59 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 99.57 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 99.57 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 99.55 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 99.55 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 99.54 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 99.54 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 99.53 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 99.53 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 99.52 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 99.5 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 99.5 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 99.47 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 99.46 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 99.46 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 99.46 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 99.45 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 99.45 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 99.45 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 99.45 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 99.44 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 99.43 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 99.43 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 99.43 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 99.42 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 99.39 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 99.39 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 99.37 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 99.34 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 99.32 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 99.3 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 99.28 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 99.25 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 99.25 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 99.22 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 99.16 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 99.15 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 99.11 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 99.09 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 98.93 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 98.91 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 98.81 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 98.81 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 98.8 | |
| d1fp1d2 | 244 | Chalcone O-methyltransferase {Alfalfa (Medicago sa | 98.78 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 98.77 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 98.73 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 98.72 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 98.66 | |
| d1inla_ | 295 | Spermidine synthase {Thermotoga maritima [TaxId: 2 | 98.64 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 98.63 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 98.63 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 98.63 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 98.63 | |
| d1af7a2 | 193 | Chemotaxis receptor methyltransferase CheR, C-term | 98.61 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 98.59 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 98.53 | |
| d1xdza_ | 239 | Glucose-inhibited division protein B (GidB) {Bacil | 98.51 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 98.48 | |
| d2o07a1 | 285 | Spermidine synthase {Human (Homo sapiens) [TaxId: | 98.48 | |
| d2b2ca1 | 312 | Spermidine synthase {Caenorhabditis elegans [TaxId | 98.48 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 98.4 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 98.4 | |
| d2okca1 | 425 | Type I restriction enzyme StySJI M protein {Bacter | 98.36 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 98.31 | |
| d2dula1 | 375 | N(2),N(2)-dimethylguanosine tRNA methyltransferase | 98.26 | |
| d1ej0a_ | 180 | RNA methyltransferase FtsJ {Escherichia coli [TaxI | 98.25 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 97.91 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 97.76 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 97.75 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 97.71 | |
| d2bm8a1 | 232 | Cephalosporin hydroxylase CmcI {Streptomyces clavu | 97.64 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 97.63 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 97.56 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 97.56 | |
| d2p41a1 | 257 | An RNA cap (nucleoside-2'-O-)-methyltransferase do | 97.54 | |
| d1o9ga_ | 249 | rRNA methyltransferase AviRa {Streptomyces viridoc | 97.49 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 97.39 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 97.36 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 97.31 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 97.31 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 97.28 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 97.27 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 97.17 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 97.17 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 97.14 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 97.1 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 96.92 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 96.86 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 96.86 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 96.86 | |
| d1i4wa_ | 322 | Transcription factor sc-mtTFB {Baker's yeast (Sacc | 96.84 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 96.8 | |
| d1vj0a2 | 182 | Hypothetical protein TM0436 {Thermotoga maritima [ | 96.75 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 96.71 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 96.69 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 96.69 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 96.67 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 96.63 | |
| d1f8fa2 | 174 | Benzyl alcohol dehydrogenase {Acinetobacter calcoa | 96.61 | |
| d1kola2 | 195 | Formaldehyde dehydrogenase {Pseudomonas putida [Ta | 96.6 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 96.56 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 96.56 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 96.56 | |
| d1jqba2 | 174 | Bacterial secondary alcohol dehydrogenase {Clostri | 96.55 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 96.53 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 96.53 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 96.52 | |
| d1m6ex_ | 359 | Salicylic acid carboxyl methyltransferase (SAMT) { | 96.38 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 96.38 | |
| d1pl8a2 | 171 | Ketose reductase (sorbitol dehydrogenase) {Human ( | 96.3 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 96.22 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 96.21 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 96.18 | |
| d1e3ja2 | 170 | Ketose reductase (sorbitol dehydrogenase) {Silverl | 96.16 | |
| d2g72a1 | 263 | Phenylethanolamine N-methyltransferase, PNMTase {H | 96.16 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 96.16 | |
| d1e3ia2 | 174 | Alcohol dehydrogenase {Mouse (Mus musculus), class | 96.15 | |
| d1yb5a2 | 174 | Quinone oxidoreductase {Human (Homo sapiens) [TaxI | 96.12 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 96.09 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 96.08 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 96.08 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 96.06 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 96.05 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 96.03 | |
| d1piwa2 | 168 | Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas | 95.99 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 95.97 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 95.93 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 95.7 | |
| d1llua2 | 166 | Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax | 95.66 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 95.66 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 95.66 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 95.61 | |
| d1p0fa2 | 174 | Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: | 95.58 | |
| d1h2ba2 | 172 | Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ | 95.32 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 95.28 | |
| d1jvba2 | 170 | Alcohol dehydrogenase {Archaeon Sulfolobus solfata | 95.25 | |
| d2uyoa1 | 297 | Putative methyltransferase ML2640 {Mycobacterium l | 95.22 | |
| d1d1ta2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 95.21 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 95.2 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 95.18 | |
| d1rjwa2 | 168 | Alcohol dehydrogenase {Bacillus stearothermophilus | 94.93 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 94.88 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 94.86 | |
| d2ifta1 | 183 | Putative methylase HI0767 {Haemophilus influenzae | 94.82 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 94.7 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 94.65 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 94.59 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 94.52 | |
| d1dcta_ | 324 | DNA methylase HaeIII {Haemophilus aegyptius [TaxId | 94.42 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 94.14 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 94.02 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 94.01 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 93.95 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 93.93 | |
| d1pqwa_ | 183 | Putative enoyl reductase domain of polyketide synt | 93.91 | |
| d1uufa2 | 168 | Hypothetical protein YahK {Escherichia coli [TaxId | 93.78 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 93.78 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 93.72 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 93.7 | |
| d1eg2a_ | 279 | m.RsrI N6 adenosine-specific DNA methyltransferase | 93.59 | |
| d2fzwa2 | 176 | Alcohol dehydrogenase {Human (Homo sapiens), diffe | 93.58 | |
| d1v3va2 | 182 | Leukotriene b4 12-hydroxydehydrogenase/prostagland | 93.36 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 93.09 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 93.07 | |
| d1zq9a1 | 278 | Probable dimethyladenosine transferase {Human (Hom | 93.01 | |
| d2c7pa1 | 327 | DNA methylase HhaI {Haemophilus haemolyticus [TaxI | 92.95 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 92.83 | |
| d1iz0a2 | 171 | Quinone oxidoreductase {Thermus thermophilus [TaxI | 92.73 | |
| d1qora2 | 179 | Quinone oxidoreductase {Escherichia coli [TaxId: 5 | 92.52 | |
| d1g60a_ | 256 | Methyltransferase mboII {Moraxella bovis [TaxId: 4 | 92.04 | |
| d1g55a_ | 343 | DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | 92.01 | |
| d1booa_ | 320 | m.PvuII N4 cytosine-specific DNA methyltransferase | 91.79 | |
| d1vj1a2 | 187 | Putative zinc-binding alcohol dehydrogenase {Mouse | 91.67 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 91.49 | |
| d1pjca1 | 168 | L-alanine dehydrogenase {Phormidium lapideum [TaxI | 91.4 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 91.0 | |
| d1xg5a_ | 257 | Putative dehydrogenase ARPG836 (MGC4172) {Human (H | 90.42 | |
| d2g5ca2 | 171 | Prephenate dehydrogenase TyrA {Aquifex aeolicus [T | 90.32 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 90.16 | |
| d1xa0a2 | 176 | B. subtilis YhfP homologue {Bacillus stearothermop | 90.16 | |
| d2f1ka2 | 165 | Prephenate dehydrogenase TyrA {Synechocystis sp. p | 90.14 | |
| d1gu7a2 | 189 | 2,4-dienoyl-CoA reductase {Yeast (Candida tropical | 89.72 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 89.24 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 89.23 | |
| d2jhfa2 | 176 | Alcohol dehydrogenase {Horse (Equus caballus) [Tax | 89.19 | |
| d2py6a1 | 395 | Methyltransferase FkbM {Methylobacillus flagellatu | 88.56 | |
| d1rjda_ | 328 | Leucine carboxy methyltransferase Ppm1 {Baker's ye | 88.46 | |
| d1yb1a_ | 244 | 17-beta-hydroxysteroid dehydrogenase type XI {Huma | 87.02 | |
| d1g0oa_ | 272 | 1,3,8-trihydroxynaphtalene reductase (THNR, naphto | 86.83 | |
| d1wmaa1 | 275 | Carbonyl reductase/20beta-hydroxysteroid dehydroge | 86.61 | |
| d1ja9a_ | 259 | 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl | 86.49 | |
| d1zkda1 | 365 | Hypothetical protein RPA4359 {Rhodopseudomonas pal | 85.15 | |
| d1iy8a_ | 258 | Levodione reductase {Corynebacterium aquaticum [Ta | 82.84 | |
| d1luaa1 | 191 | Methylene-tetrahydromethanopterin dehydrogenase {M | 82.75 | |
| d1xkqa_ | 272 | Hypothetical protein R05D8.7 {Caenorhabditis elega | 82.63 | |
| d1f0ya2 | 192 | Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum | 82.43 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 81.94 | |
| d1ae1a_ | 258 | Tropinone reductase {Jimsonweed (Datura stramonium | 81.67 | |
| d1zema1 | 260 | Xylitol dehydrogenase {Gluconobacter oxydans [TaxI | 81.6 | |
| d1kyza2 | 243 | Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra | 81.59 | |
| d1jsxa_ | 207 | Glucose-inhibited division protein B (GidB) {Esche | 81.07 | |
| d1cdoa2 | 175 | Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI | 80.96 | |
| d1lssa_ | 132 | Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax | 80.95 | |
| d2gdza1 | 254 | 15-hydroxyprostaglandin dehydrogenase, PGDH {Human | 80.83 | |
| d1bg6a2 | 184 | N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A | 80.16 | |
| d1tt7a2 | 167 | Hypothetical protein YhfP {Bacillus subtilis [TaxI | 80.06 | |
| d1o89a2 | 177 | Hypothetical protein YhdH {Escherichia coli [TaxId | 80.05 | |
| d1xhla_ | 274 | Hypothetical protein F25D1.5 {Caenorhabditis elega | 80.01 |
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: S-adenosyl-L-methionine-dependent methyltransferases superfamily: S-adenosyl-L-methionine-dependent methyltransferases family: Arginine methyltransferase domain: Arginine methyltransferase, HMT1 species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.94 E-value=4.1e-27 Score=217.50 Aligned_cols=155 Identities=47% Similarity=0.848 Sum_probs=142.6
Q ss_pred hhhhhhccchhhhhhhhchhHHHHHHHHHHHhcCCCCCCCeEEEecCCCChhhHHHHhcCCceEEeeecCCCcccHHHHH
Q psy8709 111 KYYFNSYEDAHIHAEMIKDTVRTESYKSAILNNNSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSGTPIRTESYK 190 (319)
Q Consensus 111 ~~yf~~y~~~~~~~~m~~d~~r~~~~~~~i~~n~~~~~~~~vLD~G~GsG~l~i~aa~~ga~~V~avd~d~~~~~~~~~~ 190 (319)
+.||++|+++.+|+.|++|..|+..|.++|..+...+++
T Consensus 1 d~yf~~y~~~~~h~~ml~D~~r~~~y~~aI~~~~~~~~~----------------------------------------- 39 (328)
T d1g6q1_ 1 DYYFDSYDHYGIHEEMLQDTVRTLSYRNAIIQNKDLFKD----------------------------------------- 39 (328)
T ss_dssp CCCCCCCCCHHHHHHHHTCHHHHHHHHHHHHHHHHHHTT-----------------------------------------
T ss_pred CCcchhhcCchHHHHHhCCHHHHHHHHHHHHhccccCCc-----------------------------------------
Confidence 369999999999999999999999999998776655555
Q ss_pred HHHhcccccCCCcceeeccCCCchHHHHHHHcCCCEEEEEecHHHHHHHHHHHHhcCCCCcEEEEEcCccccccCCCcee
Q psy8709 191 SAILNNKSLFNNKHVIDVGAGTGILSIFAAQAGAAKVFAIEKSDIAYETIDIIRKNKYDSQIEVYHKLLEDVELPVESVD 270 (319)
Q Consensus 191 ~~i~~~l~~~~~~~VLDiGcGtG~ls~~la~~g~~~V~gvD~s~~i~~a~~~~~~~g~~~~i~~i~~d~~~~~~~~~~fD 270 (319)
++|||+|||+|.+++.+++.|+.+|+|+|.|+++..|+++.+.++..++++++++++.+++++.++||
T Consensus 40 ------------~~VLDlGcGtG~ls~~aa~~Ga~~V~avd~s~~~~~a~~~~~~~~~~~~i~~i~~~~~~l~~~~~~~D 107 (328)
T d1g6q1_ 40 ------------KIVLDVGCGTGILSMFAAKHGAKHVIGVDMSSIIEMAKELVELNGFSDKITLLRGKLEDVHLPFPKVD 107 (328)
T ss_dssp ------------CEEEEETCTTSHHHHHHHHTCCSEEEEEESSTHHHHHHHHHHHTTCTTTEEEEESCTTTSCCSSSCEE
T ss_pred ------------CEEEEeCCCCCHHHHHHHHhCCCEEEEEeCCHHHHHHHHHHHHhCccccceEEEeehhhccCccccee
Confidence 78889999999999989998888999999999778899999999998999999999999999889999
Q ss_pred EEEeccchhhhcchhhHHHHHHHHhcccCCCcEEEeecCcceeecccc
Q psy8709 271 IIISEWMGYFLLFETMIDSVIDARNRFLKPDGVVCPNRFTLSLCGAYA 318 (319)
Q Consensus 271 ~Iis~~~~~~l~~~~~~~~~l~~~~r~LkpgG~li~~~~t~~~~~~~~ 318 (319)
+|+++++++++.++..+..++.++.++|||||+++|+.++++++|+..
T Consensus 108 ~i~se~~~~~~~~e~~~~~~~~a~~r~LkpgG~iiP~~~~~~~~~v~~ 155 (328)
T d1g6q1_ 108 IIISEWMGYFLLYESMMDTVLYARDHYLVEGGLIFPDKCSIHLAGLED 155 (328)
T ss_dssp EEEECCCBTTBSTTCCHHHHHHHHHHHEEEEEEEESCEEEEEEEEECC
T ss_pred EEEEEecceeeccchhHHHHHHHHHhccCCCeEEEeeecceeeecccC
Confidence 999999999999999999999999999999999999999999999864
|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} | Back information, alignment and structure |
|---|
| >d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} | Back information, alignment and structure |
|---|
| >d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} | Back information, alignment and structure |
|---|
| >d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2uyoa1 c.66.1.57 (A:14-310) Putative methyltransferase ML2640 {Mycobacterium leprae [TaxId: 1769]} | Back information, alignment and structure |
|---|
| >d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} | Back information, alignment and structure |
|---|
| >d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} | Back information, alignment and structure |
|---|
| >d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} | Back information, alignment and structure |
|---|
| >d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} | Back information, alignment and structure |
|---|
| >d1rjda_ c.66.1.37 (A:) Leucine carboxy methyltransferase Ppm1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} | Back information, alignment and structure |
|---|
| >d1zkda1 c.66.1.52 (A:2-366) Hypothetical protein RPA4359 {Rhodopseudomonas palustris [TaxId: 1076]} | Back information, alignment and structure |
|---|
| >d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} | Back information, alignment and structure |
|---|
| >d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} | Back information, alignment and structure |
|---|
| >d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} | Back information, alignment and structure |
|---|
| >d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} | Back information, alignment and structure |
|---|
| >d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} | Back information, alignment and structure |
|---|
| >d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|