Diaphorina citri psyllid: psy871

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MFQIWDWFTGVLGYLGLWTKSGKLLFLGLDNAGKTTLLHMLKDDRLAQPVPTLHPILGYLGLWTKSGKLLFLGLDNAGKTTLLHMLKDDRLAQPVPTLHPTRRVWKDYFPAVDAIVFLVDTSDRERFEESKSELQCLLTDESLASSIVFLVDTSDRERFEESKSELQCLLTDESLASCPVLILGNKIDKHGAASEEEIRQYFGLYGLTTGKVATPRSEMSGRPIELFMCSVLMRQGYGDGFRWLANYID
ccHHHHHHHHHHHHHccccccEEEEEEEccccccHHHHHccccccccccccccHHHHHccccccEEcEEEEEEEEccccHHHHHHHcccccccccccccccccEEEEEEECccEEEEEEEcccccccHHHHHHHHHHccccccccEEEEEEEcccHHHHHHHHHHHHHcccccccccccEEEEEccccccccccHHHHHHHHcccccccccccccccccccccEEEEEccccccccHHHHHHHHHHccc
MFQIWDWFTGVLGYLGLWTKSGKLLFLGLDNAGKTTLLHMLKDDRLAQPVPTLHPILGYLGLWTKSGKLLFLGLDNAGKTTLLHMLKDDRLAQPVPTLHPTRRVWKDYFPAVDAIVFLVDTSDRERFEESKSELQCLLTDESLASSIVFLVDTSDRERFEESKSELQCLLTDESLASCPVLILGNKIDKHGAASEEEIRQYFGLYGLTTGKVATPRSEMSGRPIELFMCSVLMRQGYGDGFRWLANYID
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQIWDWFTGVLGYLGLWTKSGKLLFLGLDNAGKTTLLHMLKDDRLAQPVPTLHPILGYLGLWTKSGKLLFLGLDNAGKTTLLHMLKDDRLAQPVPTLHPTRRVWKDYFPAVDAIVFLVDTSDRERFEESKSELQCLLTDESLASSIVFLVDTSDRERFEESKSELQCLLTDESLASCPVLILGNKIDKHGAASEEEIRQYFGLYGLTTGKVATPRSEMSGRPIELFMCSVLMRQGYGDGFRWLANYID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Small COPII coat GTPase SAR1 Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. SAR1 controls the coat assembly in a stepwise manner. Activated SAR1-GTP binds to membranes first and recruits the SEC23/24 complex. These SEC23/24-SAR1 prebudding intermediates are then collected by the SEC13/31 complex as subunits polymerize to form coated transport vesicles. Conversion to SAR1-GDP triggers coat release and recycles COPII subunits.confidentQ6BVA7
GTP-binding protein SAR1b Involved in transport from the endoplasmic reticulum to the Golgi apparatus. Activated by the guanine nucleotide exchange factor PREB. Involved in the selection of the protein cargo and the assembly of the COPII coat complex.confidentQ5PYH3
GTP-binding protein SAR1b Involved in transport from the endoplasmic reticulum to the Golgi apparatus. Activated by the guanine nucleotide exchange factor PREB. Involved in the selection of the protein cargo and the assembly of the COPII coat complex.confidentQ9CQC9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016529 [CC]sarcoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0043229, GO:0044464, GO:0016528, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0006888 [BP]ER to Golgi vesicle-mediated transportprobableGO:0051234, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0000902 [BP]cell morphogenesisprobableGO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0009306 [BP]protein secretionprobableGO:0033036, GO:0046903, GO:0006810, GO:0071702, GO:0044765, GO:0045184, GO:0032940, GO:0008104, GO:0044763, GO:0051649, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0042175 [CC]nuclear outer membrane-endoplasmic reticulum membrane networkprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0012505, GO:0044425
GO:0006464 [BP]cellular protein modification processprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006998 [BP]nuclear envelope organizationprobableGO:0006996, GO:0006997, GO:0016044, GO:0009987, GO:0016043, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007029 [BP]endoplasmic reticulum organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0044431 [CC]Golgi apparatus partprobableGO:0005737, GO:0005794, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0019898 [CC]extrinsic to membraneprobableGO:0005575, GO:0044425, GO:0016020
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005813 [CC]centrosomeprobableGO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0043581 [BP]mycelium developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0007264 [BP]small GTPase mediated signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005774 [CC]vacuolar membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0048081 [BP]positive regulation of cuticle pigmentationprobableGO:0048087, GO:0048079, GO:0051094, GO:0050793, GO:0048070, GO:0008150, GO:2000026, GO:0051239, GO:0048518, GO:0065007, GO:0050789
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0030127 [CC]COPII vesicle coatprobableGO:0043227, GO:0043226, GO:0043229, GO:0030117, GO:0030133, GO:0030135, GO:0030134, GO:0005737, GO:0005575, GO:0031982, GO:0030662, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0048475, GO:0030658, GO:0030659, GO:0012505, GO:0012506, GO:0012507, GO:0030120, GO:0031090, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0050774 [BP]negative regulation of dendrite morphogenesisprobableGO:0022604, GO:0044707, GO:0051239, GO:0022603, GO:0030154, GO:0051129, GO:0051128, GO:0060284, GO:0031345, GO:0031344, GO:0044699, GO:0050767, GO:0048869, GO:0050768, GO:0050789, GO:0045664, GO:0010769, GO:0065007, GO:0010721, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0044763, GO:0010975, GO:0048731, GO:0022008, GO:0051093, GO:0048699, GO:0007399, GO:0050773, GO:0048856, GO:0051960, GO:2000026, GO:0048814, GO:0007275, GO:0008150, GO:0048523
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0003400 [BP]regulation of COPII vesicle coatingprobableGO:0044710, GO:0048209, GO:0055086, GO:0046434, GO:0060341, GO:0033043, GO:0051049, GO:0032386, GO:0009143, GO:0009144, GO:0009146, GO:0051128, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0034655, GO:0006195, GO:0046130, GO:0050789, GO:0009119, GO:1901361, GO:0046700, GO:0006139, GO:0046128, GO:0072523, GO:0071704, GO:0042278, GO:0009259, GO:1901069, GO:1901068, GO:0009199, GO:1901657, GO:0065007, GO:1901360, GO:0009141, GO:0006152, GO:0019637, GO:0046483, GO:0044281, GO:0009150, GO:0060628, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:1901575, GO:0060627, GO:0009261, GO:0019439, GO:0009117, GO:0009116, GO:0008152, GO:0006184, GO:0043254, GO:0032879, GO:0009056, GO:0050794, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:0090113, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:0044087, GO:0006796, GO:1901292, GO:0006793, GO:0009207, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0035050 [BP]embryonic heart tube developmentprobableGO:0072358, GO:0007507, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0072359, GO:0048513, GO:0008150, GO:0048731, GO:0035295, GO:0032502, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0035293 [BP]chitin-based larval cuticle pattern formationprobableGO:0032502, GO:0042337, GO:0042335, GO:0044707, GO:0007389, GO:0032501, GO:0048856, GO:0007591, GO:0007275, GO:0008363, GO:0002165, GO:0002164, GO:0044767, GO:0003002, GO:0035017, GO:0008150, GO:0009791, GO:0042303, GO:0040003, GO:0044699, GO:0002168
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1F6B, chain A
Confidence level:very confident
Coverage over the Query: 9-60,110-249
View the alignment between query and template
View the model in PyMOL
Template: 2FA9, chain A
Confidence level:very confident
Coverage over the Query: 56-87,100-118,151-249
View the alignment between query and template
View the model in PyMOL