Diaphorina citri psyllid: psy8739


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
AATEKIAKQLQHQLNEVQGKLDETNRSLNDFDAAKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESSGWVEELTKGSIEAITLKSLDLDVLNFTTENSHSFSISLYSQDTVDRLQQEEDARNQLFQQKKKLEQENGGLKKDIEDLEGDVEKQKRKIEGDLKLTQEAVADLERNKKELEQTIQRKDKEIASLTAKLEDEQGLVGKNQKQIKELQARIEELEEEVEAERQSRAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAEMSKLRRDLEEANIQHESTLANLRKKHNDAVSEMGEQIDQLNKLKTKAEHERNAAHNETNNTRAAADQLAREKAATEKIAKQLQHQLNEVQGKLDETNRSLNDFDAAKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEEGRERATLLGKFRNLEHDIDNIREQLEEEAEGKADLQRQLSKANADAQLWRTKYESEGVARAEELEESKSEERRVDDLAAELDASQKECRNYSTELFRLKGAYEEAQEQLEAVRRENKNLA
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
*****IA*******************************************************************************ELTKGSIEAITLKSLDLDVLNFTTENSHSFSISLY***************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************************LF************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AATEKIxxxxxxxxxxxxxxxxxxxxxLNDFDAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEDTKRLADEESSGWVEELTKGSIEAITLKSLDLDVLNFTTENSHSFSISLYSQDTVDRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTSAQIELxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTRAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLNDFDAAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEDTKRLADEEGRExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxYESEGVAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxNKNLA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Myosin heavy chain, muscle Muscle contraction.confidentP05661

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030898 [MF]actin-dependent ATPase activityprobableGO:0016787, GO:0016818, GO:0042623, GO:0003824, GO:0016817, GO:0017111, GO:0016462, GO:0003674, GO:0016887
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0008307 [MF]structural constituent of muscleprobableGO:0003674, GO:0005198
GO:0006936 [BP]muscle contractionprobableGO:0032501, GO:0044707, GO:0003012, GO:0008150, GO:0044699, GO:0003008
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005863 [CC]striated muscle myosin thick filamentprobableGO:0015629, GO:0030016, GO:0030017, GO:0043229, GO:0043228, GO:0044430, GO:0043226, GO:0005856, GO:0044446, GO:0032982, GO:0005859, GO:0016459, GO:0005737, GO:0044424, GO:0043234, GO:0036379, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0016460, GO:0043292, GO:0044422, GO:0044449
GO:0031672 [CC]A bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0031674 [CC]I bandprobableGO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0005703 [CC]polytene chromosome puffprobableGO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0009987 [BP]cellular processprobableGO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 317-384
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:very confident
Coverage over the Query: 244-266
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:confident
Coverage over the Query: 175-302
View the alignment between query and template
View the model in PyMOL
Template: 2OCY, chain A
Confidence level:probable
Coverage over the Query: 448-497,512-535
View the alignment between query and template
View the model in PyMOL
Template: 3TNU, chain B
Confidence level:probable
Coverage over the Query: 122-207
View the alignment between query and template
View the model in PyMOL
Template: 3BAS, chain A
Confidence level:probable
Coverage over the Query: 20-79
View the alignment between query and template
View the model in PyMOL
Template: 2YCU, chain A
Confidence level:probable
Coverage over the Query: 140-302
View the alignment between query and template
View the model in PyMOL