Diaphorina citri psyllid: psy8758

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20

MQHVTHTVWSLDNKFVISASDEMNLRVWKAHASEKLGPIRKVVMSLRSNMVSWNPMEAFVFTAANEDFNLYSYDIRQLNSPLNVHKDMTSAAANEDFNLYSYDIRQLNSPLNVHKDMTSAVTSVDYSPTGREFVAGGYDKSLRLYLAHQGHSRDIYHTKRMQHVTHTVWSLDNKFVISASDEMNLRVWKAHASEKLEH

cccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEcccccccEEEEEEEEcccccEEEEEEccccEEEEccccccccccccccccEEEEEcccccEEEEEccccccccEEEccccccEEEEEEcccccEEEEECccccEEEEEccccCEEEEccccccccEEEEEEcccccEEEEEcccccEEEEEccccccccc

MQHVTHTVWSLDNKFVISASDEMNLRVWKAHASEKLGPIRKVVMSLRSNMVSWNPMEAFVFTAANEDFNLYSYDIRQLNSPLNVHKDMTSAAANEDFNLYSYDIRQLNSPLNVHKDMTSAVTSVDYSPTGREFVAGGYDKSLRLYLAHQGHSRDIYHTKRMQHVTHTVWSLDNKFVISASDEMNLRVWKAHAS*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MQHVTHTVWSLDNKFVISASDEMNLRVWKAHASEKLGPIRKVVMSLRSNMVSWNPMEAFVFTAANEDFNLYSYDIRQLNSPLNVHKDMTSAAANEDFNLYSYDIRQLNSPLNVHKDMTSAVTSVDYSPTGREFVAGGYDKSLRLYLAHQGHSRDIYHTKRMQHVTHTVWSLDNKFVISASDEMNLRVWKAHASEKLEH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DDB1- and CUL4-associated factor 13	Possible role in ribosomal RNA processing. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.	confident	Q803X4

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044424 [CC]	intracellular part	probable	GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0032991 [CC]	macromolecular complex	probable	GO:0005575

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NR0, chain A
Confidence level:very confident
Coverage over the Query: 2-196
View the alignment between query and template
View the model in PyMOL