Diaphorina citri psyllid: psy877


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MIGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNTGALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSYNDTHAQKK
ccccccccccccEEEECccHHHHHHHHHHHHHccHHHHHHHHccEEECccccHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccccccccccccccEEEEEcccccccccHHHHHHHHHHHHHcccc
MIGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQA***********TGALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSY*D******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGEPSCWLIRGSTARIPNKDSANGCEIRWSSTGLMDRIREVKSVYCEPRRNDELENVMLGYFTAIKQAELRSSNTSEKNTGALLFTIFRGKISEGIDFADNYARSVISVGIPFPSIQDEKVKLKRSYNDTHAQKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044428 [CC]nuclear partprobableGO:0005575, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044260 [BP]cellular macromolecule metabolic processprobableGO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0003678 [MF]DNA helicase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674, GO:0004386
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0006357 [BP]regulation of transcription from RNA polymerase II promoterprobableGO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0044238 [BP]primary metabolic processprobableGO:0008150, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A15, chain A
Confidence level:very confident
Coverage over the Query: 2-68,81-133
View the alignment between query and template
View the model in PyMOL